Accurate evaluation of health status of lithium-ion batteries must be deemed as of great significance, insofar as utility and safety of batteries are of concern. Lithium plating, in particular, is notoriously known to be a chemical reaction that can cause deterioration in, or even fatal hazards to, the health of lithium-ion batteries. Electrochemical impedance spectroscopy (EIS), which has distinct advantages such as fast or non-destructive over its competitors, suffices in detecting lithium plating and thus has been attracting increasing attention in the field of battery management, but its ability of assessing quantitatively the degree of lithium plating remains largely unexplored hitherto. On this point, this work seeks to narrow that gap, by proposing an EIS-based method that can quantify the degree of lithium plating. The core conception is to eventually circumvent the reliance on state-of-health measurement, and use instead the impedance spectrum, to acquire an estimate on battery capacity loss. To do so, the effects of solid electrolyte interphase formation and lithium plating on battery capacity must be first decoupled, so that the mass of lithium plating can be quantified. Then, based on an impedance spectrum measurement, the parameters of the fractional equivalent circuit model (ECM) of the battery can be identified. These fractional ECM parameters are received as inputs by an artificial neural network, which is tasked to establish a correspondence between the model parameters and the mass of lithium plating. The empirical part of the work revolves around the data collected from an aging experiment, and the validity of the proposed method is truthfully attested by dismantling the batteries, which is otherwise not needed during the actual uptake of the method.

The adapted Posner spatial cue-target paradigm was used to explore the relationship between exogenous temporal attention caused by rhythm and endogenous and exogenous spatial attention. The study was divided into two experiments. In Experiment 1, 33 participants used arrow cues to orient endogenous spatial attention and rhythm to orient exogenous temporal attention. In Experiment 2, with 29 participants, exogenous spatial attention was directed by highlighting the cue box. Exogenous temporal attention was directed by rhythm. Experiment 1 indicated that RTs were faster for attended targets than the unattended. The main effect of temporal attention was significant, with RTs being faster for synchrony and late compared to early. RTs were faster for late compared to synchrony. The main effect of stimulus repetition was significant, with faster RTs for targets when the rhythmic cue consisted of five compared to four. The interaction between spatial attention and temporal attention was not significant. Experiment 2 demonstrated that exogenous spatial attention only exhibited IOR under early four stimulus repetitions. The main effect of temporal attention was significant, with RTs being faster for synchrony and late compared to early. The main effect of stimulus repetition was significant, with faster RTs for targets when the rhythmic cue consisted of five compared to four. The interaction between spatial attention and temporal attention was significant. The results indicated that rhythmic temporal attention supported foreperiod effects. Exogenous temporal attention and endogenous spatial attention independently affect behavior, while exogenous temporal attention and exogenous spatial attention mutually influenced behavior.

An equation for the Fermi level of impurity isotropic semiconductors is considered when the bottom of the conduction band and the top of the valence band are at the center of the first Brillouin zone. The energy of charge carriers in the valence and conduction bands of semiconductors is considered taking into account the real positions of the top of the valence band and the bottom of the conduction band in the first Brillouin zone. A universal equation for determining the Fermi levels of impurity isotropic semiconductors is presented.

Normally, the Nernst voltage calculated from the concentration of the reaction gas in the flow channel is considered to be the ideal voltage (reversible voltage) of the oxyhydrogen fuel cell, but actually it will cause a concentration gradient when the reaction gas flows from the flow channel through the gas diffusion layer to the catalyst layer. The Nernst voltage loss in fuel cells in most of the current literature is thought to be due to the difference in concentration of reaction gas in the flow channel and concentration of reaction gas on the catalyst layer at the time when the high net current density is generated. Based on the Butler-Volmer equation in oxyhydrogen fuel cell, this paper demonstrates that the Nernst voltage loss is caused by the concentration difference of reaction gas in flow channel and on the catalytic layer at the time when equilibrium potential (Galvanic potential) of each electrode is generated.

As the PCIe 6.0 specification places higher requirements on signal integrity and transmission la-tency, it becomes especially important to improve signal transmission performance at the physical layer of the transceiver interface. Retimer circuit as a key component of high-speed serial interface, its delay and jitter size directly affect the overall performance of PCIe. For the conventional Retimer circuit with large latency and low jitter performance, this paper proposes a low latency and low jitter Retimer circuit based on CDR+PLL architecture for PCIe 6.0, using a jitter canceling filter circuit to eliminate the frequency difference between the retiming clock and data, reduce the retiming clock jitter, and improve the quality of Retimer output data; The data is sampled using the retiming clock and then output, avoiding the problem of large penetration latency of con-ventional Retimer circuits. The circuit is designed using CMOS 28nm process. Simulation results show that when 112Gbps PAM4 data is input to the Retimer circuit, the Retimer penetration la-tency is 27.3 ps, which is 83.5% lower than the conventional Retimer structure; the output data jitter is 741 fs, a 31.4% reduction compared to the conventional Retimer structure.

In order to improve the performance of soft plantation wood, an environmentally friendly inorganic-organic hybrid wood modifier was developed. First, using urea and melamine as crosslinking agents, the waterborne glucose silicone resin (MUG) was prepared with glucose under the catalysis of inorganic acid and metal ions. Then MUG resin was diluted to 10% and 20% mass fraction, and compounded with sodium silicate (S) of 20% and 10% mass fraction, so the inorganic-organic hybrid G10S20 and G20S10 wood modifier were obtained respectively. Then plantation poplar wood (Populus tomentosa) were impregnated and modified with them. Their physical and mechanical properties were tested and compared with those of the wood treated with S of 20% mass fraction (S20). Infrared analysis showed that amino resin characteristic structure (CO-NH-) existed in MUG resin. The resin has good permeability. Compared with S20 modified wood, the degree of shrinkage of G10S20 or G20S10 modified wood is reduced, their moisture absorption is reduced, and their dimensional stability is improved. Waterborne glucose silicone modifier can effectively improve the wood density, modulus of elasticity, modulus of rapture and compression strength. SEM analysis showed that the cell wall of G20S10 modified wood was significantly thicker than the untreated wood, and there were columnar and granular solid substances attached in some cell cavities, ducts and corners, etc. EDX showed that the number of Si elements on the cell wall was significantly increased compared with the control, indicating that the modifier effectively entered the wood cell wall. The waterborne glucose silicone resin can greatly improve the physical and mechanical properties of wood through organic-inorganic hybridization. It is a green, non-formaldehyde, eco-friendly, low cost, compound wood modifier with broad application prospects.

The teaching and learning environment have changed significantly over the last decade with the integration of an increasing amount of information and communication technologies, especially in distance education due to global pandemics, total lockdowns, isolation, and quarantine periods. The number of numerous virtual and non-virtual tools involved in educational processes is growing day by day. In terms of technological innovations used in learning environments, many researchers and educators are trying their best to bring more creative ideas into the technology- based learning environments. Although higher educational institutions have greatly benefited from the growing number of hardware and software resources in the educational process, they have also faced some setbacks that have harmed the learning processes. These technologies have in turn complicated some of the processes in the learning atmosphere. Therefore, we take Spanish teaching course as an example to present the challenging smarter teaching and learning systems that higher educational institutions face today.

Laser-targeted weeding methods further enhance the sustainable development of green agriculture, with one key technology being the improvement of weed localization accuracy. Here, we propose an improved YOLOv8 instance segmentation based on bidirectional feature fusion and deformable convolution (BFFDC-YOLOv8-seg) to address the challenges of insufficient weed localization accuracy in complex environments with resource-limited laser weeding devices. Initially, by training on extensive datasets of plant images, the most appropriate model scale and training weights are determined, facilitating the development of a lightweight network. Subsequently, the introduction of the Bidirectional Feature Pyramid Network (BiFPN) during feature fusion effectively prevents the omission of weeds. Lastly, the use of Dynamic Snake Convolution (DSConv) to replace some convolutional kernels enhances flexibility, benefiting the segmentation of weeds with elongated stems and irregular edges. Experimental results indicate that the BFFDC-YOLOv8-seg model achieves a 4.9% increase in precision, an 8.1% increase in recall rate, and a 2.8% increase in mAP50 value to 98.8% on a vegetable weed dataset compared to the original model. It also shows improved mAP50 over other typical segmentation models such as Mask R-CNN, YOLOv5-seg, and YOLOv7-seg by 10.8%, 13.4%, and 1.8%, respectively. Furthermore, the model achieves a detection speed of 24.8 FPS on the Jetson Orin nano standalone device, with a model size of 6.8MB that balances between size and accuracy. The model meets the requirements for real-time precise weed segmentation, suitable for complex vegetable field environments and resource-limited laser weeding devices.

Recently, polyetheretherketone (PEEK) has shown promising dental applications; although surface treatment is essential for dental applications owing to its poor surface energy and wettability, no consensus on an effective treatment method has been achieved. In this study, we attempt to carboxylate PEEK sample surfaces via Friedel–Crafts acylation using succinic anhydride and AlBr3. The possibility of further chemical modifications using carboxyl groups is examined. The samples are subjected to dehydration–condensation reactions with 1H,1H-pentadecafluorooctylamine and N,N'-dicyclohexylcarbodiimide. The sample surface properties at each reaction stage are evaluated. An absorption band in the 3300–3500 cm-1 wavenumber region is observed. Additionally, peak suggestive of COOH is observed in the sample spectra. Secondary modification diminished the absorption band in 3300–3500 cm-1 and a clear F1s signal is observed. Thus, Friedel–Crafts acylation with succinic anhydride produces carboxyl groups on the PEEK sample surfaces. Further chemical modification of the carboxyl groups by dehydration-condensation reactions is also possible. Thus, a series of reactions can be employed to impart desired chemical structures to PEEK surfaces.

It was believed that the construction of large dams in the upper tributary basin of the Chao Phraya River (CPR) has caused sediment load reduction in the CPR system by 75–85%. Based on historical and observed river flow and sediment data measured during 1922–2019, we investigated the effects of three large dams, the Sirikit, Naresuan, and Khwae Noi dams, on river runoff and sediment loads supplied to the CPR using Mann-Kendall (MK) test and the double mass curve (DMC). Results from this study revealed that the Nan River contributed approximately 40% and 57% of the runoff and total sediment load (TSL) to the CPR, respectively. The water regulation by the Naresuan diversion dam has mainly caused the reduction on annual runoff and TSL downstream of each dam. The results from this study also reveal that the sediment load observed at the headwater (C.2) of the CPR still increased after the construction of the Sirikit dam due to the expansion of irrigation areas downstream of the dam and the channel improvement in the lower reach of Nan River. After the three major dams were operated, the sediment load at C.2 reduced by 31% compared that discharging during the pre-construction period.

As a behavior of bilingual individuals and an indispensable part of bilingual speech, code-switching has been investigated by many researchers. However, there are many variables influencing code-switching, and each variable has the potential to be a confounding variable. Among these variables is the gender; however, whether there are significant gender differences and what are the gender differences in code-switching remains unknown for Mandarin Mandarin-English child bilinguals, as previous literature diverse on the existence of gender differences. Therefore, this paper seeks potential code-switching and distribution of code-switching by quantitative analysis of speech data in Singapore Bilingual Corpus. The results indicate that gender differences are significant in the amount of intra code-switching. However, neither considerable gender difference is observed in the amount of inter nor the code-switching related environment.

Critically ill patients with COVID-19 may develop serious respiratory difficulties, causing a significant reduction in blood oxygen saturation pressure. Physical Ventilation of the lungs is one of the main methods to help critically ill patients through the acute phase of infection. During extreme situations when dysfunctional lungs are filled with sticky sputum in the alveolus or when there are simply not enough ventilators to match the need, the mortality rate can be dramatically increased. Here, we propose an intravenous injection method that may increase and maintain the blood oxygen pressure at normal levels. The intravenous (IV) infusion contains oxygen nanobubbles in physiological saline solution (ONPS), in which the dissolved oxygen content can be 2-6 times higher than the normal oxygen solubility in pure water. This makes it possible to oxygenate blood with a small limited volume of IV fluid without the risk of gaseous bubble formation in blood vessels.

Free volume is an extremely important intrinsic defect in polymers. Structurally, the free volume is the randomly distributed holes in the polymer molecular chain segments. From the perspective of molecular movement, it is also the space needed for the movement of molecular segments. In proton exchange membrane fuel cells, the free volume is also the space needed for the directional conduction of protons. Irradiation grafting sulfonated polyvinylidene fluoride (PVDF) is one of the methods to produce proton exchange membrane with good proton channel rate. Using the LYS-1 program, based on the linear absorption coefficient and backscatter coefficient models, the percentage of annihilated positrons in PVDF in the two-layer model and the three-layer model was studied, and comparing the two fitting results it is determined that the model closest to the positron annihilation percentage required by the PALS experiment is the two-layer model, which allows the percentage of positrons that are annihilated in PVDF films with a thickness of 100 μm to reach 46% using the high energy positron source ⁴⁴Ti without using the positron moderator. Using positron annihilation lifetime spectrum (PALS) analysis methods, based on Eldrup's classical model of free volume, the influence of absorbed doses of α particles on the free volume and crystallinity of PVDF was investigated, respectively. Based on the two test results the model of cross-linking and degradation of polyvinylidene fluoride irradiated by α particles was determined. Afterwards, X-ray diffraction (XRD) methods was used to study the change of PVDF crystal area before and after irradiation. The XRD results are consistent with the results measured by PALS.

Freezing/thawing indices are important indicators of dynamics of frozen ground on the Qinghai-Tibet Plateau (QTP), especially for areas with limited observations. Based on the numerical outputs of Community Land Surface Model version 4.5 (CLM4.5) from 1961 to 2010, this study compared the spatial and temporal variations between air freezing/thawing indices (2 m above the ground) and ground surface freezing/thawing indices in permafrost and seasonally frozen ground (SFG) across the QTP, after presenting changes of frozen ground distribution in each decade in the context of warming and wetting. The results indicate that an area of 0.60×106 km2 permafrost of QTP degraded to SFG in 1960s-2000s, and the primary shrinkage period occurred in 2000s. The air freezing index (AFI) and ground freezing index (GFI) decreased dramatically at the rates of 71.00℃·d/decade and 34.33℃·d/decade from 1961 to 2010, respectively. In contrast, the air thawing index (ATI) and ground thawing index (GTI) increased strikingly with the values of 48.13℃·d/decade and 40.37℃·d/decade in the past five decades. Permafrost showed more pronounced changes in freezing/thawing indices since 1990s compared to SFG. The changes of thermal regimes in frozen ground shows closely relations to air warming until the late 1990s, especially in 1998 when the QTP has undergone the most progressively warming. However, a sharp increase in the annual precipitation from 1998 seems to take a stronger control role on thermal degradation in frozen ground than the air warming in 2000s. Meanwhile, the prominent vegetation expansion further promotes thermally unstable of frozen ground in this highly wetting period.

Keywords: mHealth; peritoneal dialysis; functionality; usability

Endoplasmic reticulum (ER) stress triggers a series of signaling and transcriptional events termed the unfolded protein response (UPR). Severe ER stress is associated with the development of fibrosis in different organs including lung, liver, kidney, heart, and intestine. ER stress is an essential response of epithelial and immune cells in the pathogenesis of inflammatory bowel disease (IBD) including Crohn’s disease. Intestinal epithelial cells are susceptible to ER stress-mediated damage due to secretion of a large amount of proteins that are involved in mucosal defense. In other cells, ER stress is linked to myofibroblast activation, extracellular matrix production, macrophage polarization, and immune cell differentiation. This review focuses on the role of UPR in the pathogenesis in IBD from an immunologic perspective. The roles of macrophage and mesenchymal cells in the UPR from in vitro and in vivo animal models are discussed. The links between ER stress and other signaling pathways such as senescence and autophagy are introduced. Recent advances in the understanding of the epigenetic regulation of UPR signaling are also updated here. The future directions of development of the UPR research and therapeutic strategies to manipulate ER stress levels are also reviewed.

With the advent of Neural Machine Translation, the more the achievement of human-machine parity is claimed at WMT, the more we come to ask ourselves if their evaluation environment can be trusted. In this paper, we argue that the low quality of the source test set of the news track at WMT may lead to an overrated human parity claim. First of all, we report nine types of so-called technical contaminants in the data set, originated from an absence of meticulous inspection after web-crawling. Our empirical findings show that when they are corrected, about 5% of the segments that have previously achieved a human parity claim turn out to be statistically invalid. Such a tendency gets evident when the contaminated sentences are solely concerned. To the best of our knowledge, it is the first attempt to question the “source” side of the test set as a potential cause of the overclaim of human parity. We cast evidence for such phenomenon that according to sentence-level TER scores, those trivial errors change a good part of system translations. We conclude that to overlook it would be a mistake, especially when it comes to an NMT evaluation.

In the pursuit of China’s dual carbon goals, identifying spatio-temporal changes in industrial carbon emission efficiency and their influencing factors in cities at different stages of development is the key to effective formulation of countermeasures to promote the low-carbon transformation of Chinese national industry and achieve high-quality economic development. In this study, we used balanced panel data of 270 Chinese cities from 2005 to 2020 as a research object: (1) to show spatio-temporal evolution patterns in urban industrial carbon emission efficiency; (2) to analyze the aggregation characteristics of industrial carbon emission efficiency in Chinese cities using Global Moran's I statistics; and (3) to use the hierarchical regression model for panel data to assess the non-linear impact of the digital economy on the industrial carbon emission efficiency of cities. The results show the following: (1) the industrial carbon emission efficiency of Chinese cities exhibited an upward trend from 2005 to 2020, with a spatial distribution pattern of high in the south and low in the north; (2) China's urban industrial carbon emission efficiency is characterized by significant spatial autocorrelation, with increasing and stabilizing correlation, and a relatively fixed pattern of spatial agglomeration; (3) there is a significant inverted-U-shaped relationship between the digital economy and the industrial carbon emission efficiency of cities. The digital economy increases carbon emissions and inhibits industrial carbon-emission efficiency in the early stages of development, but inhibits carbon emissions and promotes industrial carbon emission efficiency in mature developmental stages. Therefore, cities at all levels should reduce pollution and carbon emissions from high-energy-consuming and high-polluting enterprises, gradually reduce carbon-intensive industries, and accelerate the digital transformation and upgrading of enterprises. Western, central and eastern regions especially should seek to promote the sharing of innovation resources, strengthen exchanges and interactions relating to scientific and technological innovation, and jointly explore coordinated development routes for the digital economy.

Concrete cracks and local damage can affect the bond performance between concrete and steel bars, thereby reducing the durability of reinforced concrete structures. Compared with general concrete crack repair methods, biomineralization repair not only has effective bonding capabilities but is also particularly environmentally friendly. In view of this, this study aimed to apply biomineralization technology to repair damaged fiber-reinforced lightweight aggregate concrete (LWAC). Two groups of LWAC specimens were prepared. The control group used lightweight aggregates (LWAs) without bacterial spores and nutrient sources, and the experimental group used LWAs containing bacterial spores and nutrient sources. These specimens were first subjected to compression tests and pull-out tests, respectively, and thus were damaged. After the damaged specimen healed itself in different ways for 28 days, secondary compression and pull-out tests were conducted. The self-healing method of the control group involved placing the specimens in an incubator. The experimental group was further divided into experimental group I and experimental group II. The self-healing method of experimental group I was the same as that of the control group. The self-healing method of experimental group II involved soaking the specimen in a mixed solution of urea and calcium acetate for two days, and then taking it out and placing it in an incubator for two days, with a cycle of four days. The test results showed that, compared with the control group specimens, the relative bond strength ratio of the experimental group II specimens increased by 17.9%. Moreover, the EDS and XRD analysis results confirmed that the precipitate formed at the crack was calcium carbonate, which improved the compressive strength and bond strength after self-healing. This indicates that the biomineralization maintenance method used in experimental group II is more effective.

The accuracy of sales prediction models based on the big data of online word-of-mouth (eWOM) is still not satisfied. We argue that eWOM contains heat and sentiments of different product dimensions, which can improve the accuracy of these models. In this paper, we propose a dynamic topic analysis (DTA) framework in order to extract heat and sentiments of product dimensions from the big data of eWOM. Finally, we propose an autoregressive-heat-sentiment (ARHS) model, which integrates heat and sentiments of dimensions into the baseline predictive model. The empirical study in movie industry confirms that heat and sentiments of dimensions can improve the accuracy of sales prediction model. ARHS model is better for movie box-office revenue prediction than other models.

With increasing demand from unmanned driving and robotics, more attention has been paid to point cloud-based 3D object accurate detection technology. However, due to the sparseness and irregularity of the point cloud, the most critical problem is how to utilize the relevant features more efficiently. In this paper, we proposed a point-based object detection enhancement network to improve the detection accuracy in the 3D scenes understanding based on the distance features. Firstly, the distance features are extracted from the raw point sets and fused with the raw features about reflectivity of the point cloud to maximizing the use of information in point cloud. Secondly, we enhanced the distance features and raw features that we collectively refer to them as self-features of the key points in Set Abstraction (SA) layers with the self-attention mechanism, so that the foreground points can be better distinguished from the background points. Finally, we revised the group aggregation module in SA layers to enhance the feature aggregation effect of key points. We conducted experiments on the KITTI dataset and nuScenes dataset and the results show the enhancement method proposed in this paper has excellent performance.

This study explores the public library service evaluation domain through user-generated content on Google Maps, highlighting digital feedback's significant yet underexplored potential in understanding public library patronage across Taiwan's six major cities. Utilizing a mixed-methods research design, this study integrates Google Maps review content analysis with Social Network Analysis to delineate public perceptions and identify areas for service enhancement in public libraries. It innovatively leverages personal experiences extracted from over 60,000 Google Maps reviews to evaluate public library services in cities such as Taipei, New Taipei, Taoyuan, Taichung, Tainan, and Kaohsiung. The research taps into the National Library of Taiwan's National Library Statistics System to provide a robust analysis of library performance and user satisfaction, offering a novel perspective by emphasizing user-centric feedback from Google Maps as a primary data source. This approach provides quantitative data on library usage and geographic distribution and enriches our understanding of the qualitative experiences of library users. In analyzing the keywords from Google Maps reviews of public libraries, we categorize and interpret these under the three core LibQUAL+ dimensions—Affect of Service, Information Control, and Library as Place. The findings expose variances in perceived service quality among the cities, with Kaohsiung and Taichung receiving the highest accolades for service satisfaction. Simultaneously, the study identifies potential areas for improvement, particularly in cities with lower satisfaction ratings like Taipei. This personalized feedback illustrates the intimate relationship between public libraries and their communities, offering invaluable insights for policymakers and library management to enhance service delivery and user experience.

With worsening environmental degradation and increasing international demand for human health, plant cell based technology will be more important. The aim of this review is to give an overview regarding key points of current progress and development trend of nature medical and edible plants from the framework of whole plant cell engineering including cell cultures, cell fusion and cell splitting derived biotechnology. Here we sum up three main application trends of medical plants cell cultures covering industrial output, technology upgrading and potential resource development. We also provide classification and typification insights to summarize the development of somatic hybridization in cereal, vegetables crops and other medicinal and edible plants as well as application of artificial polyploidy induction in major medicinal herbs. Development medicinal and edible homologous plants based on modern plant cell engineering will bring us a promising future.

These days, numerous organizations and Analysis Centers (AC) offer various Ambiguity Resolution (AR) products using various methodologies. To use it for time-frequency transfer, there is no associated study. This paper chooses 16 MGEX stations with external high-precision atomic clocks to constitute 15 international time comparison links and uses AR products data from CNES, SGG, CODE, and PRIDE laboratory, using three ambiguity-fixed strategies, to thoroughly evaluate the effects of various strategies and AR products for high-precision time-frequency transfer. We reach the following results by using the IGS final clock product as a reference and comparing it to ambiguity-float. With various ambiguity-fixed procedures, the time stability STD of time transfer is increased for a single GPS, and the improvement ranges from 10% to 40%. The frequency stability has barely improved; up to 40%, the most notable improvement comes from FCB with GRM products. The time stability STD of combinations has improved after the addition of the Galileo system compared to the single GPS, and the improvement ranges from 2% to 9%. Most strategies have improved, while a few techniques have weakened with the GEC (GPS+Galileo+BDS) combination. We feel that the stability has not significantly increased with the system's increase within short-term stability after comparing multiple groups of linkages.

Smart City has emerged as the mainstream paradigm for urban governance innovation, sustainable development, and strategy upgrades, which is drawing attention from scholars worldwide. However, current frameworks for Smart City assessment remain incomplete and simplistic. In is paper, 30 national or provincial capitals in China were selected and we designed a tri-dimensional SPI model—Social, Physical, and Information Space—for smart city spatial development assessment. Utilizing methods such as entropy weighting, coupled coordination degree models, and the Dagum Gini coefficient, this study assesses the spatial development and coupled coordination of 30 cities from 2011 to 2019. Finally, by means of BP neural networks, the study examines the contribution of each indicator to the spatial coupled coordination. The results indicated that with a narrowing disparity in development speeds among different regions, the spatial coupled coordination development level of smart capitals in China has steadily increased, presenting a pattern of staggered distribution. Moreover, the IS subsystem plays the most significant role in coupled coordination. The significance of this research lies in its tri-dimensional spatial perspective of the spatial development and coupled coordination differences of the Smart City, providing evidence-based support for the regional layout and optimization in China.

Due to poor ventilation conditions in the tunnel, if gas pipeline leaks, the consequence of the accident will be more serious. Therefore, before the emergency repair, gas in the tunnel needs to be excharged so as not to explode during the repair process. Therefore, it is necessary to study the ventilation of gas in the tunnel. Based on the computational fluid dynamics (CFD) theory and taking the Yanyingshan tunnel section of China-Myanmar pipeline as an example, this paper uses Fluent software to establish the leakage model of the gas pipeline and fan model in the tunnel and analyzes the influence of different fan locations and number of fans on gas concentration. It can be concluded that: (1) the use of press-in method makes it more efficient to discharge gas out of the tunnel. (2) In order to make ventilation efficient, the fan should be arranged in a higher position and needs to be at a distance from the top of the tunnel. (3) Parallel use of two fans has better ventilation effect than single fan.

A novel coronavirus (2019-nCoV) was first identified in Wuhan, Hubei Province, and then spreads to the other Provinces of China. 2019-nCoV was reported to share the same receptor, Angiotensin-converting enzyme 2 (ACE2), with SARS-CoV. Previous studies have found ACE2 is abundantly present in humans in the epithelia of the lung and small intestines, and they found ACE2 expression in the basal layer of the non-keratinizing squamous epithelium in nasal and oral mucosa and the nasopharynx. Here based on the public single-cell RNA-Seq datasets, we analyzed the ACE2 expression in the nasal, mouth, lung, and colon tissues. We find that the number of ACE2-expressing cells in the nasal tissue and mouth is comparable to the number of ACE2-expressing cells in the lung tissue and colon. We also find that ACE2 tends to be co-expressed with HLA-DRB1, which plays a central role in the immune system by presenting peptides derived from extracellular proteins, in the nasal, mouth, lung, and colon tissues at single-cell resolution. We hope this provides valuable information for virus-prevention strategy and therapeutic strategy development.

This study aimed to understand the status of knowledge, attitudes, and practices (KAP) of norovirus infection among primary and junior middle school students in Chizhou City, explore its influencing factors. A multistage stratified random sampling method was used to randomly select 1200 students from 8 primary and junior middle schools for the effective questionnaire survey in Chizhou City. A multivariate logistic regression analysis was used to analyse the possible influencing factors. Of 1176 participants, the average knowledge score of norovirus infection was (9.8 ± 3.6), and the scoring rate was 65.3%. The average attitude score was (11.6 ± 1.2), and the scoring rate was 96.3%. The average practice score was (10.4 ± 1.5), and the scoring rate was 86.9%. The difference in the average scoring rate among the three was statistically significant (P < 0.001). The four independent variables of county, education level, sex and age group statistically correlated with the knowledge score. Primary and junior middle school students in Chizhou City had a good attitude and practice compliance in the prevention and control of norovirus infection; however, their professional knowledge still needed further improvement.

Ovarian cancer is the most frequent cause of deaths in gynecologic malignancies. Many possible mechanisms have been proposed via RNAseq and DNAseq technique recently. However, the driving factors are still obscure. The possible reasons are attributed to the incomplete human reference. This study integrated the canonical mapping-based and mapping-free protocols to extract reliable variations and novel events. We eventually obtained 450 reliable SNVs from the WES data and novel events from the RNAseq data, including 154 SNVs, 462 intron events, two repeats and six splice events. We identified six differentially expressed genes and six contigs that are significantly related to survival prognosis. The recurrent SNVs in significantly differentially expressed genes can be validated in an independent cohort of 20 Chinese ovarian cancer patients.

Forest ecosystems make a greater contribution to carbon (C) stocks than any other terrestrial ecosystem. To understand the role of regional forest ecosystems in global climate change and carbon exchange, forest C stock and its spatial distribution within the small (2,300 km2) Liuxihe River basin were analyzed to determine the different contributors to the C stock. Forest C stocks were quantified by measuring the biomass of trees, understory vegetation, litter and roots, as well as soil organic C, using data from field samples and laboratory experiments. The results showed that forests stored 38.04 Tg C in the entire basin, with secondary and planted forests accounting for 89.82% and 10.18%, respectively, of the stored C. Five types of forests, a subtropical evergreen broad-leaved forest, a subtropical coniferous and broad-leaved mixed forest, a subtropical coniferous forest, a timber forest, and a non-wood forest, stored 257.55 ± 15.01, 218.92 ± 9.59, 195.24 ± 18.29, 177.42 ± 17.55, and 117.86 ± 6.04 Mg C ha−1, respectively. In the forest ecosystem C stocks of the basin, soils averagely contribute about 73.78%, not including root underground biomass. It provides a comprehensive method for forest ecosystem carbon investigation and forest management in small basin scale.

The International Roughness Index (IRI) is the standard scale for evaluating road roughness in many countries in the world. The Taipei City government actively promotes a Road Smoothing Project and plans to complete the rehabilitation of the main and minor roads within its jurisdiction. This study aims to detect the road surface roughness in Taipei City and recommend appropriate IRI thresholds for road rehabilitation. A total of 171 asphalt concrete pavement sections in Taipei City with a total length of 803.49 km were analyzed and compared by IRI. The longitudinal profile of the detected road sections was measured using an inertial profiler. The statistical analysis showed that the IRI value prior to road leveling was mainly distributed between 5 and 8 m/km, while the IRI value after road leveling was mainly distributed between 3 and 4.5 m/km. This confirms that the implementation of the Road Smoothing Project has a significant effect on improving road smoothness. Moreover, based on the analysis results, it is recommended that the IRI threshold value for road rehabilitation in Taipei City be set at 4.50 m/km.

Ship detection from synthetic aperture radar (SAR) imagery is crucial for various fields in real-world applications. Numerous deep learning-based detectors have been investigated for SAR ship detection, which require a substantial amount of labeled data for training. However, SAR data annotation is time-consuming and demands specialized expertise, resulting in that deep learning-based SAR ship detectors struggle due to a lack of annotations. With limited labeled data, semi-supervised learning is a popular approach for boosting detection performance by excavating valuable information from unlabeled data. In this paper, a semi-supervised SAR ship detection network is proposed, termed as Multi-Teacher Dempster-Shafer Evidence Fusion Net-work (MTDSEFN). The MTDSEFN is an enhanced framework based on the basic teacher-student skeleton frame, comprising two branches: the Teacher Group (TG) and the Agency Teacher (AT). The TG utilizes multiple teachers to generate pseudo-labels for different augmentation versions of unlabeled samples, which are then refined to obtain high-quality pseudo-labels by using Dempster-Shafer (D-S) fusion. The AT not only serves to deliver weights of its own teacher to the TG at the end of each epoch, but also updates its own weights after each iteration, enabling the model to effectively learn rich information from unlabeled data. The combination of TG and AT guarantees both reliable pseudo-label generation and learning comprehensive diversity information from numerous unlabeled samples. Extensive experiments were performed on two public SAR ship datasets, and the results demonstrated the effectiveness and superiority of the proposed approach.

SARS-CoV-2, the causal agent of the globally spreading COVID-19, is capable of infecting variable animals besides human being. We evaluated the potential susceptibility of important livestock, pets and aquatic mammals by performing a multi-species sequence analysis of ACE2 based on the reported affected and unaffected animals. We identified a triple amino acid pattern of ACE2, at position 30, 31 and 34, that might be associated with SARS-CoV-2 infection and H34 might be an indicator of the susceptibility to COVID-19.

In view of increasing concerns over non-renewable resource depletion and waste management, this study aimed to apply the Taguchi optimization technique to determine the process conditions for producing bricks by incorporating thin film transition liquid crystal displays (TFT-LCD) waste glass powder with reservoir sediments. An orthogonal array L₁₆(4⁵) was adopted, which consisted of five controllable four-level factors (i.e., cullet content, drying method, preheat time, sintering temperature, and error). Moreover, the analysis of variance method was used to explore the effects of the experimental factors on the density, water absorption, shrinkage ratio, loss of ignition, porosity, and compressive strength of the fired bricks. The microstructures of the fired specimens were investigated by scanning electron microscopy. Then, the large-scale production techniques for fired bricks containing recycled TFT-LCD glass cullet and reservoir sediments was developed in a commercially available tunnel kiln. The test results showed that the structure of fired specimen was loose at a sintering temperature ranged from 900–950 °C. However, the fired specimen showed a significant densification at the sintering temperature of 1050 °C. In addition, Taguchi method is a feasible approach for optimizing process condition of brick using recycled TFT-LCD glass cullet and reservoir sediments and it significantly reduces the number of tests. On the other hand, the characteristics of fired bricks developed in the tunnel kiln were in compliance with Chinese National Standards class Ι building bricks criteria.

: The silicon single crystals for semiconductor application is usually grown by Czochralski (CZ) method. This paper researches 300mm silicon Czochralski (CZ) crystal growth with CUSP magnetic field for IGBTs substrate application. The different positions of Zero-Gauss plane (ZGP) under CUSP magnetic field are simulated and compared to numerical analysis, investigated melt convection, melt flow velocity near to quartz crucible wall, diffusion boundary layer and effect of initial oxygen concentration in the silicon crystal, and the shape of solid/liquid interface was discussed. The results show that the change of the ZGP of the CMF mainly affects the convection in the melt, which leads to the difference of the thickness of the boundary layer near to the wall of the quartz crucible, and was found to be the key to reduce the oxygen dissolution from the crucible wall and oxygen diffuse into the crystal, along with the differences in the shape of the crystal-melt interface. In addition, we have carried out actual industrial single crystal production under the three configurations. The results show that the experimental data of oxygen content and shape of the crystal-melt interfaces in silicon crystal are consistent with the numerical results.

This article addresses the trajectory tracking between two non-identical systems with chaotic properties. We employ the Rossler chaotic and RCL-shunted Josephson junctions model in similar phase space to study trajectory tracking. In order to achieve the goal tracking, we afford two stages to approximate the target tracking. The first stage utilizes the active control technique to transfer the output signal from the RCLs-J system into the quasi-Rossler system. Then next, the RCLs-J system employs the proposed the iterative learning control scheme and the control signal from the drive system to trace the trajectory of Rossler system. The numerical results demonstrate the proposed method and the tracking system is asymptotically stable.

This research not only dedicated a less restrictive method of iteration-varying function for a learning control law to design a controller but also synchronize two nonlinear systems with free time-delay. In addition, the mathematical theory of system synchronization has proved rigorously and the theory verified through an example to demonstrate the behavior of each parameter in the theory. The design of a controller using the iterative learning control law is significant for robotic tracking. The controller in this research generates a feed-forward control input using the error dynamics among the drive-response systems. The error dynamics satisfies the Lyapunov function and the combination of output errors, which respectively represented relative estimated differences of the drive-response systems. The iterative learning control rule serves the function of a filter adding previous control error after the end of each iteration. The numerical example of a synchronous system is given a Lorenz system for driving and another with the iterative learning control law for response under different initial condition. The results verify and demonstrate the proposed mathematical theory. The simulation exhibits consistency in the behavior of each parameter to match mathematical theory.

The study aimed to estimate the prevalence and associated factors of cervical and breast cancer screening among women in the general population in Jordan. Nationally representative cross-sectional data were analysed from 14,689 women (34 years median age, range 15-49) that took part in the “2017-18 Jordan Population and Family Health Survey”. Information about cancer screening uptake included Pap smear, clinical breast examination, and mammography. Results indicate that the prevalence of ever Pap smear cancer screening was 15.3%, clinical breast examination in the past 12 months 13.9% and ever mammography 8.7%. In adjusted logistic regression analysis, older age, higher wealth, greater media exposure and tobacco use were positively and being Syrian, and living in the southern region were negatively associated with ever Pap smear, clinical breast examination in the past 12 months, and ever mammography. In addition, high decision-making power was associated with the uptake of Pap smear and higher education was associated with ever mammography. The study showed a low cancer screening uptake, and several factors were identified that can assist in promoting cancer screening in Jordan.

In all areas of medicine, especially in radiology, computers are increasing year by year. Filmless radiology, speech recognition software, electronic application forms, and teleradiology are recent developments that have greatly improved radiologists' performance. This research explores radiology software trends, predictions, and the challenges posed by informatics and historical trend analysis. The rationale behind this research is that information technology (IT) is overgrowing almost every day. We must continuously seek new ways to apply IT to make more use of resources. Consequently, IT becomes increasingly crucial to radiology organizations' innovative thinking, workflow, and business models. This study aimed to analyze all radiology software publications in the Science Citation Index (SCI). From 1991 to July 2021, SCI was used to search for publications systematically. We have also widely used this historical method in radiology software research. The findings and discussions are base on an assessment of trends, predictions, contributions, and challenges in radiology software, and we are exploring radiology software with six evolutionary stages. The gift of this research is that radiology managers realize that the use of new information technologies is closely related to survival in a competitive environment. Radiology companies can review these new technologies to develop more innovative business models and services to improve operational deficiencies.

Taiwan is the world’s leading country regarding tuna longline fisheries; the combined catches with those from Japan account for more than half of the global total. However, the bycatch of sea turtles, seabirds, and dolphins in longline fisheries has attracted international concern. Regarding sea turtle conservation, the use of circle hooks in longline fisheries will inevitably become a trend. Meanwhile, Taiwanese fishermen are concerned whether the use of circle hooks will have a negative impact on the catch efficiency of target species. This study was conducted to compare the catch efficiency of circle and tuna hooks by the Taiwanese commercial tuna longline fishing vessels in the eastern Pacific Ocean. The results indicated that if the effects of immersion time were considered, the catch rates of all groups were the same between 4.2-sun circle and tuna hooks. However, the catch rate of 4.0-sun circle hooks was significantly higher than the two types of 4.2-sun circle and tuna hooks. Regarding survival rates, fish caught with circle hooks showed higher survival rates than tuna hooks for total commercial fish, tunas and yellowfin tuna (Thunnus albacares). However, the survival rate was only determined at haulback; the relationship between survival rate and immersion time still needs further investigation. Regarding catch sizes, there were no significant differences in the sizes of bigeye (Thunnus obesus) and yellowfin tuna between circle and tuna hooks. But based solely on mean weight, the value of yellowfin tuna caught using circle hooks may be higher than those using tuna hooks. In summary, the circle hooks used in this study did not show a negative impact on the catch efficiency of Taiwanese longline fisheries, and could show a superior performance than that of tuna hooks. These results could be actively promoted in the industry through the education and training of fishermen; thus enabling Taiwan to comply with international sea turtle conservation trends.

In this nano era, nanomaterials and nanostructures are popular in developing novel functional materials. However, the combinations of nanoproducts with materials at micro and macro scale can open new routes for conceiving novel materials with an improved or even new functional performances. In this study, a brand-new hybrid, containing both nanofibers and particles having a microsize, was fabricated using a sequential electrohydrodynamic atomization (EHDA) process. Firstly, the microparticles loaded with drug (berberine hydrochloride, BH) molecules in the cellulose acetate (CA) were fabricated using a solution electrospraying process. Later, these microparticles were suspended into a co-dissolved solution containned BH and a hydrophilic polymer (polypyrrolidone, PVP), and were co-electrospun into the nanofiber/microparticle hybrids. The EHDA processes were clearly recorded, and the resultant products showed a typical hybrid topography, with microparticles distributed all over the nanofibers, which was demonstrated by SEM assessments. FTIR and XRD demonstrated that the components within the hybrids were presented in an amorphous state and have fine compatibility with each other. In vitro dissolution tests verified that the hybrids were able to provide the designed dula-step drug release profiles, a combination of the fast release step of BH from the hydrophilic PVP nanofibers through an erosion mechanism and the sustained release step of BH from the insoluble CA microparticles via a typical Fickian diffusion mechanism. The present protocols pave a new way for developing trans-scale functional materials.

Taiwan's bed and breakfast (B&B) development has been more than 25 years ago, from the first generation of retirement to the B&B industry, serving tourists from all over the world accom-modation, providing breakfast and accommodation mode to the present, after the change of employees from the second generation, more and more attention is paid to the cultivation and cultivation of business ability. With the advent of the era of AI technology networking, the ca-pabilities required for B&B operation are more focused on all aspects of service, and the good marketing ability of B&B can promote a green chimney-free tourism economy, which is also a favorite industry of various governments and the public. This study explores the basic vocational competency indicators required for running a B&B, with (1)EQ emotion management skills, (2)Financial management ability, (3)(SK) technical skills, and (4)Marketing and promotion management capabilities. Through the study method, the K-S Z test was determined by the con-sensus conclusion of expert reliability and validity p value

Human milk reduces risk for necrotizing enterocolitis in preterm infants. Necrotizing enterocolitis occurs in the ileocecal region where thousands of milk protein-derived peptides have been released from digestion. Digestion-released peptides may exert bioactivity, such antimicrobial and immunomodulatory activities, in the gut. In this study, we applied mass spectrometry-based peptidomics to characterize peptides present in colostrum before and after in vitro digestion. Sequence-based computational modeling was applied to predict peptides with antimicrobial activity. We identified more peptides in undigested samples, yet the abundances were much higher in the digested samples. Heatmapping demonstrated highly different peptide profiles between undigested and digested samples. Four peptides (αS1-casein [157–163], αS1-casein [157–165], β-casein [153–159] and plasminogen [591–597]) were selected, synthesized and tested against common pathogenic bacteria associated with necrotizing enterocolitis. All four exhibited bacteriostatic, though not bactericidal, activities against Klebsiella aerogenes, Citrobacter freundii and Serratia marcescens, but not Escherichia coli.

This study investigates the transformative impact of ChatGPT, a cutting-edge AI language model developed by OpenAI, on the financial sector. We explore ChatGPT's applications in financial analysis, focusing on its ability to perform tasks traditionally handled by human analysts. By creating a set of multi-step and advanced reasoning financial tasks, and establishing several task-specific evaluation metrics, our experimental results demonstrate that ChatGPT-4o can effectively perform both basic and some complex financial analysis tasks comparable to those executed by humans. However, our empirical evaluation reveals limitations in its performance on complex tasks that require comprehensive understanding and critical thinking. The study highlights the necessity for meticulous task formulation and robust evaluation to achieve consistent functionality. While ChatGPT enhances efficiency in financial analysis, its integration with human expertise remains crucial for effective decision-making. This study contributes to the understanding of AI's role in finance and provides insights into its potential and constraints, guiding future integration of AI technologies in financial practices.

By repeated unloading and loading of the excavation dynamic and static loads, repeated train dynamic and static loads of multi-factors, the underpass tunnel, cross tunnel engineering influence area rock layer, the existing tunnel structure of the three constitutes a multifaceted structure, multi-factor interaction system. Existing tunnels into the prediction theory model of the new tunnel excavation process of dynamic and static loads, dynamic and static loads of existing tunnels are mostly analyzed individually, the results of synergistic analysis needs to be improved. Based on the theory of the current layer method, the paper comprehensively considers the stiffness of the existing tunnel, the stiffness of the new tunnel, the excavation method load and the existing tunnel load, coupled with Peck's empirical formula, the theoretical model of deformation prediction for excavation of a two-lane highway tunnel under the tunnel through the existing railroad is proposed, and verified and optimized by numerical calculations and monitoring data, which proves the applicability and reliability of the theoretical model in the similar strata and the project promotion.

The research on the excavation mechanical properties of underpass tunnels has already had certain results, but fewer of them consider the effects of dynamic and static loads on the excavation mechanical properties of underground tunnels at the same time, especially the lack of research cases of double-line highway tunnels with angled underpasses of existing railway tunnels. In this paper, based on the tunnel project of the new double-line Shiqian Highway Tunnel passing under the Hurong Railway at an oblique angle, the mechanical parameters of the rock body in the cross-tunneling area under the influence of static and dynamic load coupling are obtained by using the disturbance quantification coefficients and the Hoek-Brown criterion based on the method of over-advanced geological prediction and the investigation of the surrounding rock on the palisade face, and the engineering-scale finite element model is constructed and the mechanical characteristics of the excavation in the tunnel of the double-lane highway tunnel passing under the existing railroad under the influence of the static and dynamic loads are analyzed. The results show that: the new tunnel rock movement law for the top of the arch sinking, bottom plate bulging, side wall to move outward, the height and width of the arch and bottom plate arch with the tunnel excavation and increase, the side wall rock displacement effect is smaller; left and right lines of the tunnel disturbed area of the rule of change is similar; the existing tunnel bottom plate displacement is more than the top plate and the left and right side walls by the excavation of the time step influence is larger. Typical profile displacement is mainly determined by the distance from the excavation surface; the new tunnel in the four types of calculation conditions of the rock disturbance angle is the same; the existing tunnel roof and side wall Von Mises stress extreme occurs in the tunnel structure, the bottom plate there are pressure relief and pressure-bearing areas; based on the displacement control criteria, the recommended upper and lower step blasting method.

This study examined the use of high dosages of ultraviolet germicidal irradiation (UVGI) (253.7 nm) to deal with various concentrations of air pollutants, such as formaldehyde (HCHO), total volatile organic compounds (TVOC), under various conditions of humidity. We also estimated the emission of ozone as a secondary pollutant of UVGI as treatment. A number of irradiation methods were applied for various durations in field studies to examine the efficiency of removing HCHO, TVOC, bacteria, and fungi. The removal efficiency of air pollutants (HCHO and bacteria) through long-term exposure to UVGI appears to increase with time. The effects on TVOC and fungi concentration were insignificant in the first week; however, improvements were observed in the second week. No differences were observed among the various irradiation methods in this study regarding the removal of HCHO and TVOC; however significant differences were observed in the removal of bacteria and fungi.

The purposes of this study are to analyze the groundwater quality of Ogallala Aquifer and evaluate the hydrological characteristics in the southern High Plains region of the Permian Basin, Texas. Levels of chloride, fluoride, nitrate, pH, selenium, and total dissolved solids (TDS) were analyzed through the years 1990-2016. A total of 133 wells were collected from the Texas Water Development Board (TWDB) which is an open database by the US government. Statistical analysis was utilized to evaluate the groundwater quality and propose trends. The average levels of the contaminants were compared to their respective Maximum Contaminant Levels (MCL) by the Environmental Protection Agency (EPA). Potential human health risks that each contaminant possesses were described. Possible sources of each contaminant were discussed with oil/gas activities, agricultural practices, and other human actions impact its conditions. This research provides important information for groundwater quality of Ogallala aquifer and contributes on understanding the response to development in the Permian Basin, Texas.

Endophytic bacteria, especially those participate in nitrogen fixation, play critical roles in supplying essential nutrients for legume plant growth. Compared to the numerous bacterial microbiome reports targeting legume roots and nodules, little is known about embryonic bacteria that facilitate plant nutrient utilization after seed germination. Here, we collected and investigated endophytic bacterial microbiomes in edible pea (Pisum sativum) embryos using five representative cultivars and a pea sprout control. Twenty-six nitrogen-fixing bacteria (NFBs) were isolated from pea embryos, with three strains found in fresh pea (FGP) and snow pea (SP) exhibiting the strongest nitrogenase activity. Some NFB isolates are also potassium-solubilizing bacteria (KSBs) or phosphorus-solubilizing bacteria (PSBs) utilizing inorganic and/or organic phosphorus. All 26 NFBs showed variable levels of indole-3-acetic acid (IAA) secretion. The nutrient-solubilizing NFBs identified in our research are valuable resources for biofertilizer development. At the microbiome level, high-throughput 16S ribosomal RNA (rRNA) sequencing of 40 bacterial collections from pea embryos revealed similar community structures and species abundances and diversities in most samples. Our embryo-derived endophytic bacterial pool provides a microbiome platform for seed dormancy and germination research of edible peas.

Promoting close and sustainable cooperation between schools, enterprises, and government has become an important concern in many countries. Based on evolutionary game theory, this paper constructs a tripartite evolutionary game model of schools, enterprises, and government in order to analyze the stability of strategies of the different players. The results show that the main factor that influences the stability of the strategies of schools and enterprises is the reward of positive cooperation from sources other than the government, and the main factor that influences the stability of the strategy of the government is the benefit of positive cooperation strategy under the scenario where schools cooperate with enterprises. Therefore, the government should focus on implementing more effective policies, such as increasing the incentives and penalties, improving the mechanism for managing conflicts, ensuring the fairness of benefits distribution, and clarifying the responsibilities of different departments; schools should focus on providing more practical curricula and programs for students, training high-quality teachers, and perfecting talent cultivation to meet the needs of enterprises; and enterprises should focus on providing job experiences for students and transforming the results of schools’ teaching and theoretical research into practical productivity.

In order to study the petrogenesis and tectonic setting of Permian A-type granites and their relationships with hydrothermal mineralization along the Hegenshan-Heihe suture zone (HHSZ) in northeastern China, we select the newly discovered Hongyan Cu-polymetallic deposit in the northeastern part of the HHSZ that develops three stages of mineralization associated with the Shanshenfu alkali-feldspar granite (SAFG). The zircon U-Pb dating and whole rock geochemistry suggest that the SAFG is a typical A-type granite formed in the Early Permian. The zircon Hf isotopes and trace elements suggest that the SAFG has high Ti-in-zircon temperature (721–990℃), high magmatic oxygen fugacity and largely positive εHf(t) (+6.0 to +9.9). Therefore, we propose that the SAFG was derived from the crustal assimilation and fractional crystallization of the charnockitized juvenile crust. The high oxygen fugacity favors the chalcophile elements (e.g., Cu, Au, Ag) of the source region enriched in the fluid phases after magmatic fractional crystallization, consequently facilitating subsequent hydrothermal mineralization, which is also consistent with the characteristics of ore-forming fluids that changed from the initial high temperature, high salinity, high fO2 and CO2-rich magmatic-hydrothermal fluids of stage I to CO2-poor, dilute, and cooling meteoric fluids of stage III. Combined with regional geological background, the Permian A2-type granites along the HHSZ can be formed in post-collisional slab break-off process. In subsequent exploration for hydrothermal deposits along the HHSZ, the Permian A-type granites with arc-related juvenile crustal source and high fO2 have great potential and need more attention.

In view of the problem of cracking easily and partial distortion of images after encryption or decryption, a novel image encryption and decryption algorithm based on Arnod Transform and fractional chaotic is proposed. To begin with, the Arnold transform is used to encrypt. So that the spatial confidence of the original image has been comprehensively disturbed. Secondly, the XOR involving the fractional order chaotic sequence is used to encrypt. The key sequence is dynamically generated to ensure the randomness and difference of key generation. When decryption is required, the first decryption is performed using the key and XOR. Then the second decryption is carried out by using the inverse Arnold transform, and finally the decrypted image is obtained. Experimental results show that the improved algorithm has achieved better performance in encryption and decryption.

The evaluation of tourism sustainability has become of paramount importance for researchers and decision-makers to better protect tourist destinations, especially with the continuous increase in the number of tourists and visitors that alter the natural components of the environment and degrade ecosystems. Therefore, the use of geographical data is of great significance, particularly in environmental monitoring and land management, due to its ease of use and availability. However, calculating composite indices for sustainability involves several steps and requires a basic understanding of existing models. This article describes the development and design of a package of plugins in QGIS that serves as an easy-to-use tool for processing and automatically calculating economic, environmental, social indices, and the overall index of tourist sustainability. These plugins have been built in Python and designed as QGIS software plugins.

Breast cancer is the most common malignancy in women worldwide. The pathogenesis of this disease is closely related to the estrogen receptor alpha subtype (ERα). Therefore, it is of great importance to develop effective inhibitors of ERα activity for the treatment of breast cancer. In this paper, we propose a novel ensemble machine learning model for quantitative structure-activity relationship of anti-breast cancer drugs, which can effectively predict drug activity in small samples with multiple characteristic variables. To avoid the problem of over-fitting caused by low-correlation independent variables, the scoring mechanism of random forest was improved by incorporating three relevance indicators, including the maximum mutual information number, Pearson correlation coefficient and distance correlation coefficient, and 20 optimal molecular descriptors were selected. The Bayesian hyperparameter optimization method was used to optimize the parameters of multiple linear regression (MLR), support vector regression (SVR), and extreme gradient boosting (XGBoost), respectively. The AdaBoost strong learner was constructed by combining the weak learner with the weighted linear addition method. The results show that the proposed ensemble learning model has the best prediction performance compared to the three basic learner models and the CNN-LSTM combination prediction model. The root mean square error was reduced by 7.60%-26.51%. The mean relative error was reduced by 6.46%-30.92%. Goodness of fit increased by 9.57%-36.94%. Finally, the biological activities of 50 candidate compounds for ERα inhibitors were predicted, and it was found that 4-[2-benzyl-1-[4-(2-pyrrolidin-1-ylethoxy)phenyl]but-1-enyl]phenol had an excellent biological activity value pIC50, which had the potential to be an ERα inhibitor. The model proposed in this paper has good prediction accuracy, which can provide an effective reference for the discovery and development of anti-breast cancer drugs.

In order to establish a new discipline specializing in accident science from the perspective of safety science. Under the guidance of the current research theories and methods of safety science, combined with the research paradigm of humanities and social medicine, this paper puts forward new viewpoints, new theories and new models about accident research. First of all, through literature retrieval, this paper analyzes the relevant research results of accidents at home and abroad, and expounds the existing problems and the basic trend of accident science research. Secondly, it puts forward eight kinds of attribute relations of the accident, and makes clear the characteristics and connotation of the accident. In the study of accident types, a hierarchical classification model based on accident cognition is created for the first time. It also points out the logical relevance of five levels of accident science research and the realistic relevance of three levels. At the same time, according to the thought of science of science, this paper puts forward a new definition of safety under the thinking of accident science and other basic concepts related to safety science, and explains the connotation. In addition, it creates and constructs the basic concept of accident science, establishes the conceptual model of accident science, and points out the “3-4-5” model of accident science research and its connotation. Thirdly, draw lessons from the interdisciplinary paradigm to study the relevant theoretical basis and discipline classification relationship of accident science, and construct the tree of accident science. Finally, the research contents of three main aspects of accident science are summarized. The results show that the research results in this paper not only play a fundamental role in the basic construction of accident science, but also further enrich and perfect the discipline system of safety science, which has a certain theoretical significance.

Resource Description Framework(RDF) is a data representation format of the Semantic Web, and its data volume is growing rapidly. Cloud-based systems provide a rich platform for managing RDF data. However, the distributed environment has performance challenges when it is processing with RDF queries that contain multiple join operations, such as network reshuffle, memory overhead. To get over these challenges, this paper proposed a spark-based RDF query architecture, which is based on Semantic Connection Set (SCS). First of all, this spark-based query architecture adopts the mechanism of re-partitioning class data based on vertical partitioning, which can reduce memory overhead and fast index data. Secondly, a method for generating query plans based on semantic connection sets is proposed in this paper. In addition, statistics and broadcast variable optimization strategies are used to reduce shuffling and data communication costs. The experiment of this paper is based on the latest SPARQLGX on the spark platform RDF system, two synthetic benchmarks are used to evaluate the query. The experiment result illustrates that the proposed approach in this paper is more efficient in data search than SPARQLGX.

Because only two variables are needed to characterize a simple thermodynamic system in equilibrium, any such system is constrained on a 2D manifold. Of particular interest are the exact 1-forms on the cotangent space of that manifold, since the integral of exact 1-forms is path-independent, a crucial property satisfied by state variables such as internal energy dE and entropy dS. Our prior work [1] shows that given an appropriate language of vector calculus, a machine can re-discover the Maxwell equations and the incompressible Navier-Stokes equations from data. In this paper, We enhance this language by including differential forms and show that machines can re-discover the equation for entropy dS given data. Since entropy appears in various fields of science in different guises, a potential extension of this work is to use the machinery developed in this paper to let machines discover the expressions for entropy from data in fields other than classical thermodynamics.

CO2 flooding stands as a pivotal technique for significantly enhancing oil recovery in low-permeability reservoirs. The movement and sweeping rules at the front of CO2 flooding play a critical role in its oil recovery, yet a comprehensive quantitative analysis remains an area in need of refinement. In this study, we have developed 1D and 2D numerical simulation models to explore the sweeping behavior of miscible, immiscible, and partly-miscible CO2 flooding patterns. The front position and movement rules of the three CO2 flooding patterns are determined. A novel approach of the contour area calculation method is introduced to quantitatively characterize the sweep coefficients, and the sweeping rules are discussed regarding geological parameters, oil viscosity, and injection-production parameters. Furthermore, the Random Forest (RF) algorithm is employed to identify the controlling factor of the sweep coefficient, as determined by out-of-bag (OOB) data displacement analysis. The results show that the miscible front is located at the point of maximum CO2 content in the oil phase. The immiscible front occurs at the point of maximum interfacial tension near the production well. Remarkably, the immiscible front moves at a faster rate compared to the miscible front. Geological parameters, including porosity, permeability, and reservoir thickness, significantly impact the gravity segregation effect, thereby influencing the CO2 sweep coefficient. Immiscible flooding exhibits the highest degree of gravity segregation, with a maximum gravity segregation degree (GSD) reaching 78.1. The permeability ratio is a crucial factor, with a lower limit of approximately 5.0 for reservoirs suitable for CO2 flooding. Injection-production parameters also play a pivotal role in sweep coefficient. Decreased well spacing and increased gas injection rates are found to enhance sweep coefficients by suppressing gravity segregation. Additionally, higher gas injection rates can improve the miscibility degree of partly-miscible flooding from 0.69 to 1.0. Oil viscosity proves to be a significant factor influencing the sweep coefficients, with high seepage resistance due to increasing oil viscosity dominating the miscible and partly-miscible flooding patterns. Conversely, gravity segregation primarily governs the sweep coefficient in immiscible flooding. In terms of controlling factors, the permeability ratio emerges as a paramount influence, with a factor importance value (FI) reaching 1.04. these results provide a theoretical foundation for the application of CO2 flooding, enhancing the understanding of the critical factors governing its success.

The performance of the absolute atom gravimeters used on moving platforms, such as vehicles, ships and aircrafts, is strongly affected by the vibration noise. To suppress its influence, we summarize a vibration compensation method utilizing data measured by a classical accelerometer. The measurements with the accelerometer show that the vibration noise in the vehicle can be 2 order of magnitude greater than that in the lab during daytime, and can induce an interferometric phase fluctuation with a standard deviation of 16.70π. With the compensation method, our vehicle-mounted atom gravimeter can work normally in these harsh conditions. Comparing the Allan standard deviations before and after the vibration noise correction, we find a suppression factor of 22.74 can be achieved in static condition with an interrogation time of T = 20 ms, resulting a sensitivity of 1.35 mGal/Hz1/2, and a standard deviation of 0.5 mGal with an average time of 10 s. We also demonstrate the first test of an atom gravimeter in a moving vehicle, in which a suppression factor of 50.85 and a sensitivity of 60.88 mGal/Hz1/2 were realized with T = 5 ms.

Taxanes, particularly docetaxel (DTX), has been widely used for combination therapy of head and neck squamous cell carcinoma (HNSCC). For locally advanced unresectable HNSCC, DTX combined with cisplatin and 5-fluorouracil as a revolutionary treatment revealed an advantage in improvement of patient outcome. In addition. DTX plus immune check inhibitors (ICIs) showed low toxicity and increased response of patients with recurrent or metastatic HNSCC (R/M HNSCC). Accumulating data indicate that taxanes not only function as antimitotics but also impair diverse oncogenic signalings including angiogenesis, inflammatory response, ROS production, and apoptosis induction. However, despite an initial response, development of resistance remains a major obstacle to treatment response. Taxane resistance could result from intrinsic mechanisms such as enhanced DNA/RNA damage repair, increased drug efflux, and apoptosis inhibition, and extrinsic effects such as angiogenesis and interactions between tumor cells and immune cells. This review provides an overview of taxanes therapy applied in different stages of HNSCC and describe the mechanisms of taxane resistance in HNSCC. Through a detailed understanding the mechanisms of resistance may help developing the potential therapeutic methods and the effective combination strategies to overcome drug resistance.

This paper proposes a new non-radial biennial Luenberger energy and environmental performance index (EEPI) to measure the EEP change in various Chinese cities. The sources of EEP change, in terms of technical efficiency change and technological change, are examined by Luenberger EEPI. The contributions from specific undesirable outputs and energy inputs to the EEP change are identified by means of the non-radial efficiency measure. The proposed approach is applied to evaluate the EEP of the industrial sector in 283 cities in China over 2010-2014. Factors influencing the emission abatement potential are investigated by employing geographically weighted regression (GWR) model. We find that 1) changes in EEP can be attributed to technological progress but that technological progress slows down across the study period; 2) the soot emission performance experiences a downtrend among four specific sub-performances in line with the truth that severe haze happened frequently in China; 3) the best performers begin to move from the coastal to inland cities with the less resource consumption and higher ecological equality; 4) cities with the strongest positive effect in regards to pollution intensity on emission abatement potential are located in the areas around the Bohai Gulf, where air pollution is particularly severe.

To determine the fracture rate of ceramic crowns and causes of ceramic crown failure, this study used keywords—namely “endocrown,” “veneered fixed dental prosthesis,” “monolithic lithium disilicate (LS2),” and “all-ceramic single crown”—to search for articles published in English from 2005 to 2023 in the PubMed electronic database. Rather than using the Boolean logic algorithm between MESH terms and keywords, we accurately calculated the numbers of final clinically tracked cases with crown fractures from the contents of articles. The titles and abstracts of many related articles focused on implant or abutment fracture, while crown fracture was investigated and mentioned only in the main texts of the articles. Our studies included those crowns as well as having more complete data collection. Our search yielded 228, 93, 404, and 358 articles for the keywords “endocrown,” “veneered fixed dental prosthesis,” “monolithic lithium disilicate (LS2),” and “all-ceramic single crown,” respectively. We used the Newcastle–Ottawa Scale (NOS) to assess article quality, and our inclusion criteria were randomized controlled trials (RCT) and cohort study articles involving more than 3 years of follow-up and more than 20 cases. After reviewing, 16 high-quality articles were selected for analysis. The 4.4% crown fracture rate recommended on the basis of most clinical results was achieved in only 6 of the 16 articles. In these 6 articles, the researchers concluded the following reasons that may cause the crown fractures: the thickness of the veneer ceramic material; the connector dimensions; pontic span of the fixed prosthesis; the type of cement; the treatment of the ceramic surface before luting. Other articles inferred that the computer-aided design libraries that were insufficient for the creation of appropriate anatomically supported frameworks for prostheses with ceramic veneers; the thermal expansion coefficient and fracture toughness of the framework material did not match those of the veneer ceramic, resulting in an insufficient area supporting the ceramic veneer then leads to premature crown failure after a long period chewing. The future prospective for material developing could focus on solving those problems and have better clinical results.

This study aimed to compare the differences in durability and prestress loss between normal-weight concrete (NC) and lightweight aggregate concrete (LWC) prestressed box girders, which were constructed at the same time in the same area, so as to verify the superiority of using synthetic lightweight aggregate (LWA) made from reservoir sediments in prestressed bridges. For the NCs and LWCs used in prestressed box girders, the basic mechanical properties were tested on the one hand, and the durability properties were tested on the other hand. Then, through the prestress monitoring system, the prestress loss of the two groups of the prestressed box girders was tracked. The results of the durability test confirmed that LWC can inhibit the penetration of air, water, and chloride ions by strengthening the interfacial transition zone between the aggregate and the cement paste, thereby improving its durability. Moreover, the magnetic flux prestress loss of the NC prestressed box girder reached 8.1%. In contrast, the magnetic flux prestress losses on both sides of the LWC prestressed box girder were 4.6% and 4.9%, respectively. This verified that, under the same environmental conditions, the use of LWC produced less of a prestress loss than the use of NC.

Background and Objectives: Chemokines have various biological functions and potential roles in the development or progression of neuroinflammatory diseases. However, the specific pathogenic roles of chemokines in age-related macular degeneration (AMD), the leading cause of blindness in older individuals, remain elusive. Chemokines interact with their receptors expressed in the endothelium and on leukocytes. The sulfation of tyrosine residues in chemokine receptors increases the strength of ligand–receptor interaction and modulates signaling. Therefore, in the present study, we aimed to construct a human recombinant sulfated CXCR3 peptide trap (hCXCR3-S2) and mouse recombinant sulfated CXCR3 peptide trap (mCXCR3-S2) to demonstrate in vivo effects in preventing choroidal neovascularization and chemotaxis. Materials and Methods: First, the effect of hCXCR3-S was validated in vitro. Interestingly, hCXCR3-S2 inhibited the migration and invasion of two human cancer cell lines. Subsequently, the in vivo efficacy of mCXCR3-S2 was investigated using a mouse model of neovascular AMD. Results: Intravitreal injection of mCXCR3-S2 attenuated choroidal neovascularization and macrophage recruitment in neovascular lesions. These in vitro and in vivo effects were significantly stronger with CXCR3-S2 than with wild-type CXCR3 peptides. Conclusion: These findings demonstrate that the sulfated form of the CXCR3 peptide trap is a valuable tool that could be supplemented with antivascular endothelial growth factors in AMD treatment.

The overpopulation of feral pigeons in Hong Kong has significantly disrupted the urban ecosystem, highlighting the urgent need for effective strategies to control their population. In general, control measures should be implemented and re-evaluated periodically following accurate estimations of feral pigeon population in the concerned regions, which, however, is very difficult in urban envi-ronments due to the concealment and mobility of pigeons within complex building structures. With the advances in deep learning, computer vision can be a promising tool for pigeon monitoring and population estimation but has not been well investigated so far. Therefore, we propose an improved deep learning model based on Mask-RCNN (Swin-Mask R-CNN) for feral pigeon detection using computer vision techniques. Specifically, our model consists of a Swin transformer network (STN) as the backbone, a feature pyramid network (FPN) as the neck, and three decoupled detection heads. The STN is utilized to extract deep feature information of feral pigeons through local and cross-window attention mechanisms. The FPN is employed to fuse multi-scale features and enhance the multi-scale learning ability. Heads in the three branches are responsible for classification, pre-dicting best bounding boxes, and segmentation of feral pigeons, respectively. During the prediction phase, a Slicing Aided Hyper Inference (SAHI) tool is employed to zoom in on the feature infor-mation of small feral pigeon targets, and the segmentation head is frozen to expedite inference of large images. Experiments were conducted on feral pigeon dataset to evaluate model performance. The results reveal that our model is well-suited for detecting small targets in high-resolution images and achieves excellent recognition performance for feral pigeons with a mAP (mean average pre-cision) and an AP50 (average precision at 50% intersection over union) of 0.74 and 0.93, respectively. For small target feral pigeons, AP50 in small scale (AP50s) improved by 10% as compared to the Mask R-CNN (AP50s of 0.75), demonstrating its potential for dynamic pigeon detection and population estimation in the future.

Our image recognition system mainly judges whether the left upper limb in the image is the left upper limb or the right upper limb through our deep learning model in the image. The doctor then could give the correct surgical position. From the experimental results, it could be found that the precision rate and recall rate of the intelligent image recognition system proposed in this paper for preventing the upper limb dislocation surgery could reach 98% and 93%, respectively. It proved that our artificial intelligent image recognition system, AIIRS, could indeed assist orthopedic surgeons to prevent the occurrence of left and right dislocation in upper limb surgery. At the same time, this paper also completes the IRB application approval through the prototype experimental results and will conduct the second phase of human trials in the future. It showed that the research results of this paper will be of great benefit and research value to upper limb orthopedic surgery.

Our image recognition system mainly judges whether the left upper limb in the image is the left upper limb or the right upper limb through our deep learning model in the image. The doctor then could give the correct surgical position. From the experimental results, it could be found that the precision rate and recall rate of the intelligent image recognition system proposed in this paper for preventing the upper limb dislocation surgery could reach 98% and 93%, respectively. It proved that our intelligent image recognition system could indeed assist orthopedic surgeons to prevent the occurrence of left and right dislocation in upper limb surgery. At the same time, this paper also completes the IRB application approval through the prototype experimental results and will conduct the second phase of human trials in the future. It showed that the research results of this paper will be of great benefit and research value to upper limb orthopedic surgery.

Empirical and theoretical advances in human neuroscience have led to a reappraisal of the relationships between mind, brain and body, the implications of which are particularly relevant to understanding emotions, which is revealed to be embodied owing to the facts that they are on the one hand primarily arise from the internal bodily states controlled by interoceptive system, on the other they give rise to physiological reactions and physical action evoked by autonomic nervous system. More specifically, when considering the ‘embodied mind’ (i.e., how mental processes are inescapably contextualized by their location within the body), the brain, instead of the ‘master’ of the body, is increasingly revealed to function as the ‘servant’, with its primary goal to maintain the body’s homeostatic integrity. This is achieved through the control of interoceptive information concerning body’s physiological state, initially as ‘simple’ organ-level homeostatic reflexes and then through higher-order coordination across organ-systems allowing ‘allostatic policies’ to predict and maintain future health of the integrated whole ‘biological-self’. In this context, motivational and emotional feelings arise from interoceptive signals that accompany (motivational and emotional) internally-directed physiological responses, and externally-directed behaviors. Emotion concepts are thus the categorized embodied outcomes of bidirectional brain-body interactions and may arguably be differentiated into afferent interoceptive processes, i.e., from body to brain, and efferent/autonomic processes, i.e., from brain to body. When comparing emotion words used in Chinese and English languages, afferent/interoceptive processes seem to dominate conceptualization of embodied emotions in Chinese, while the efferent processes feature more commonly in English. The presence of distinct conceptual systems relating to emotions may, according to the linguistic relativity hypothesis as well as the theory of constructed emotion, significantly shape the distinct values and ‘national character’ of Chinese and English–speaking cultures. Correspondingly, it is argued that, in the expression of affective traits, Chinese-speaking people are biased towards being more receptive, reflective and adaptive, whereas native English speakers may tend to be more reactive, proactive and interactive. These patterns also encompass functions historically ascribed to bodily organs by traditional Chinese and ancient Greek medicine.

Heterosis plays a significant role in enhancing variety, boosting yield, and raising economic value, but the molecular mechanism is still unclear. We analyzed the transcriptomes and 3D genomes of hybrid (F1) and its parents (w30 and 082). Analysis of the expression revealed a total of 485 specially expressed genes (SEGs), 173 differentially expressed genes (DEGs) above parental expression level, more actively expressed genes and up-regulated DEGs in F1. Further study revealed that the DEGs detected in F1 and its parents were mainly involved in response to auxin, plant hormone signal transduction, DNA metabolic process, Purine metabolism, starch and sucrose metabolism, which suggested that these biological processes may play a crucial role in the heterosis of B. rapa. The analysis of 3D genome data revealed that hybrid F1 tend to contain more transcriptionally active A compartments after hybridization. Additionally, F1 had a smaller TAD (topologically associated domain) genome length, but the number was the highest, and the expression change of activated TAD was higher than repressed TAD. More specific TAD boundaries were detected between parents and F1. Subsequently, 140 DEGs with genomic structural variants were selected as potential candidate genes. Among them, we found two DEGs with consistent expression changes in A/B compartments and TADs. Our findings suggest that genomic structural variants, such as TADs and A/B compartments, may affect gene expression and contribute to heterosis in B. rapa. This study provides further insight into the molecular mechanism of heterosis in B. rapa.

Gabapentin (GBP), a GABA analogue, is primarily used as an anticonvulsant to treat partial seizures and neuropathic pain. While a majority of the side effects are associated with the nervous system, emerging evidence suggests a high risk for heart diseases in the patients taking GBP. In the present study, we used a preclinical model of rats to investigate (1) the acute cardiovascular responses to GBP (bolus i.v. injection, 50 mg/kg) and (2) the effects of chronic GBP treatment (i.p. 100 mg/kg/day x 7 days) on cardiovascular function and the myocardial proteome. Under isoflurane-anesthesia, rat blood pressure (BP), heart rate (HR), and left ventricular (LV) hemodynamics were measured using Millar pressure transducers. The LV myocardium and brain cortex were analyzed by proteomics, bioinformatics, and western blot to explore the molecular mechanisms underlying GBP-induced cardiac dysfunction. In experiment (1), we found that i.v. GBP significantly decreased BP, HR, maximal LV pressure, and maximal and minimal dP/dt, whereas it increased IRP-AdP/dt, Tau, systolic, diastolic, and cycle durations (*p < 0.05 and **p < 0.01 vs baseline; n = 4/group). In experiment (2), we found that chronic GBP treatment resulted in hypotension, bradycardia, and LV systolic dysfunction, with no change in plasma norepinephrine. In the myocardium, we identified 109 differentially expressed proteins involved in calcium pathways, cholesterol metabolism, and galactose metabolism. Particularly, we found that calmodulin, a key protein of intracellular calcium signaling, was significantly upregulated by GBP in the heart but not in the brain. In summary, we found that acute and chronic GBP treatments suppressed cardiovascular function in rats, which is attributed to abnormal calcium signaling in cardiomyocytes. These data reveal a novel side effect of GBP independent of the nervous system, providing important translational evidence to suggest that GBP can evoke adverse cardiovascular events by depression of myocardial function.

The E-learning system has achieved great development after the pandemic. In this work, we proposed three artificial intelligence-based enhancements to our linguistic interactive E-learning system from different aspects. Compared with the original phonetic transcription exam system, our enhancements include an MFCC+CNN-based disordered speech classification module, a Transformer-based Grapheme-to-Phoneme converter, and a Tacotron2-based IPA-to-Speech speech synthesis system. This work not only provides a better experience for the users of this system but also explores the utilization of artificial intelligence technologies in the E-learning field and linguistic field.

Facilitating sustainable cooperation between schools and enterprises has become an important concern in many countries. However, there remains a gap in understanding the approaches taken by central and local governments to foster such cooperation through the lens of evolutionary game theory. Therefore, this paper aims to develop a quadrilateral evolutionary game model involving schools, enterprises, the central government, and local governments, to analyze the conditions under which governments can effectively promote school-enterprise cooperation. Our findings indicate that benefit is a decisive factor that affects the strategies of all parties. When the benefits of cooperation are sufficiently attractive, schools and enterprises are inclined to cooperate with each other independently of governmental intervention. While increasing incentives and penalties from the central government and local governments can stimulate school-enterprise cooperation, these measures are not sustainable in the long term. Additionally, the impact of the central government’s incentives and penalties on local governments in promoting school-enterprise cooperation is limited. Enhancing policy efficacy and the practical outcomes of school-enterprise cooperation is essential, which not only strengthens the bond between schools and enterprises but also ensures deep and enduring governmental involvement.

Transition metal dichalcogenides (TMDs) monolayers exhibit unique valleytronics properties due to the dependency of the coupled valley and spin state at the hexagonal corner of the first Brillouin zone. Precisely controlling valley spin-polarization via manipulating the electron population enables its application in valley-based memory or quantum technologies. This study uncovered the uncompensated spins of the antiferromagnetic oxide (NiO) serving as the ferromagnetic (FM) order to induce valley spin-polarization in molybdenum disulfide (MoS₂) monolayers via the magnetic proximity effect (MPE). A spin-resolved photoluminescence spectroscopy (SR-PL) was employed to observe MoS₂, where the spin-polarized trions appear to be responsible for the MPE, leading to a valley magnetism. Results indicate that local FM order from the uncompensated surface of NiO could successfully induce significant valley spin-polarization in MoS₂ with the depolarization temperature approximately at 100 K, which is relatively high compared to related literature. This study reveals new perspectives and potential of AFM materials in the field of exchange-coupled van der Waals heterostructures.

The development of one technology can be portrayed by common methods like Gartner’s hype cycle or S-curve, however, there is no method to characterize the feature distributions of multiple technologies within a specific domain. This study proposes a big data-based method in terms of four proposed features, namely versatility, significance, commerciality, and disruptiveness, to characterize the technologies within a given domain. The features of technologies are quantitively portrayed using the representative keywords and volumes of returned search results from Google and Google Scholar in two-dimensional analytical spaces of technique and application. We demonstrate the applicability of this method using 452 technologies in the domain of intelligent robotics. The results of our assessment indicate that the versatility values are normally distributed, while the values of significance, commerciality, and disruptiveness follow power-law distributions, in which few technologies possess higher feature values. We also show that significant technologies are more likely to be commercialized or causing potential disruption, as such technologies have higher scores in these features. Further, we validly prove the robustness of our approach via comparing historical trends with literature and characterizing technologies in reduced analytical spaces. Our method can be widely applied in analyzing feature distributions of technologies in different domains, and it can potentially be exploited in decisions like investment, trade, and science policy.

Introduction: Treating elbow fracture-dislocation is a challenge, especially in the situation of basal-coronoid trans-ulnar fracture. The study ams to explain whether or not the minimal invasive surgery (MIS) would be feasible in elbow dislocation with coronoid fracture. Materials & Methods: At Taipei Veterans General Hospital, patients who had elbow dislocations with coronoid process fractures underwent single one surgeon’s MIS techniques which included the fluoroscopy-guided ulnar anteromedial (FGUAM) approach in the stage of reducing coronoid process. When there is a proximal ulnar fracture, the posterior incision should be necessary, followed by the incision over the lateral or medial elbow in treating radial fractures or ligament injuries. Results: The Flow Diagram about approach recommendation was established in base of defining MIS as not to do cross-plane dissection. Anteriorly rigid fixation for the coronoid process was also emphasized. Conclusions: MIS can be achieved by multiple limited surgical incisions. However, if there is an unstable ulnar metaphysis or ligament avulsion fracture, the posterior approach has to be extended and the so-called MIS fails to be established.

Waxy rice is one of the most popular traditional crops served as a staple food in China. In this study, the effect of different factors including α-amylase activity, protein, and amylopectin structure on the pasting properties of four waxy rice varieties were investigated. Rice flours treated with AgNO3 solution, DL-dithiothreitol (DTT) or protease, suggested that both α-amylase activity and protein significantly decrease the pasting viscosity of waxy rice flours. Chain length distribution of amylopectin as measured by high performance ion exchange chromatography (HPAEC-PAD) showed that starch with higher ratio of short chain leading to a higher pasting viscosity. X-Ray diffractograms showed that the crystal type of all the four varieties of rice starches were characteristic A-type. Relative crystallinity of each rice starch was further calculated, and a higher crystallization resulted in a higher viscosity. Our study would provide a fundamental knowledge of the relationship between different factors and waxy starch pasting properties, as well as be a reference for controlling the quality of waxy rice starch-based food.

Few studies have paid attention to the industrial lands along the Chinese Grand Canal from a cultural per-spective, but cities along the route like Hangzhou have relied on the Canal system to promote industrializa-tion over the past hundred years, and relocated, transformed, or demolished the factories to construct cul-tural space or products mostly after industrial recession at the beginning of 21st century. To deeply analyze this process is quite helpful to understand the typical cultural change and its gain and loss along the Canal especially after cultural and creative industries have been established as the pillar industries of China's na-tional economy. Therefore, along the Hangzhou section of the Canal, we dynamically monitored the land use of the selected 10 industrial lands, with the analysis of high-resolution satellite imageries and the in-dustrial past, the areas of different uses in 2022 were compared. Meanwhile, along with archival data, fieldwork, and experts’ consultation, we designed a mark sheet with factors and scores to comprehensively assess cultural changes over those lands, and its reasons and influence also have been argued, and the prob-lems and suggestions have been offered. This study can contribute to a better understanding of public poli-cy choices in China regarding cities along the Grand Canal after the industrial decline, and provide new perspectives for cultural research, heritage conservation, and urban planning of canals or waterfront spaces.

Here, we present a series of novel block copolymers (BCP) from bio-derived monomers, poly(lactic acid)-block-poly(2,5-furandimethylene succinate) (PLA-b-PFS), in which the furan groups from PFS block can be crosslinked with bis(maleimido) triethylene glycol (M2) through a Diels-Alder reaction. This dynamic crosslinking reaction leads to a network structure for enhancing the mechanical properties compared to their linear BCP analogous. Decreasing the crosslinking density leads to a decrease of glass transition temperature of BCPs and a transition from glassy to rubbery-like behavior at room temperature. This allows a wide tunablity of both elastic moduli and yields of the materials. For the lowest crosslinking density. the material exhibits an over 50% self-healing efficiency at room temperature after five days, attributed to the low Tg (15.2 C) from the introduction of PFS block, allowing sufficient chain mobility for structure re-organization. Moreover, with the appropriate selection of crosslinking density (PLA-b-PFS/M2 (6/1)), it also shows an excellent shape memory property with a high recovery rate of 96.3% and a fixity rate of 97.3%. The permanent shape can be rewriteable due to the reversibility of Diels-Alder reaction. With these advanced functionalities and ease in large-scale fabrication, the PLA-b-PFS/M2 shows great promises for self-healing coatings or films with shape memory properties in a wide variety of applications such as packaging materials

When analyzing user geospatial information through deep learning methods, it is typically necessary to annotate existing geospatial data. Currently, manual annotation methods are commonly employed, suffering from issues related to low efficiency and accuracy. This design is based on the TensorFlow deep learning framework and first realizes the BiLSTM+CRF+AGG deep learning model. Among the models, AGG is the aggregation layer, which is introduced to solve the problem of solid particle size equilibrium. Secondly, based on the characteristics of original data and professional data, an automatic labeling algorithm is proposed. The algorithm first preprocesses the acquired original data set and professional data set, The most valuable unlabeled data set which can make the training model converge quickly is selected from the original data set as the target data set. Sort the target data set based on preset rules and set annotation parameters for the sorted target data set. Based on the set annotation parameters, the corpus is synthesized and used as the annotation result. Thirdly, based on the active learning strategy, a manual annotation auxiliary scheme is proposed, and an Excel generation module that is convenient for manual annotation correction is designed and developed to further improve the efficiency and quality of annotation through iterative processing. The combination of the BiLSTM+CRF+AGG deep learning model and high-quality annotation can accurately identify non-standard, incomplete, or even incorrect geographical information entities. This annotation method has found successful practical application within the context of the research project and has been granted an invention patent.

In this work we discuss the numerical challenges involved in the computation of the complex eigenvalues of damped multi-flexible-body problems. Aiming at the highest generality, the candidate method must be able to deal with arbitrary rigid body modes (free-free mechanisms), arbitrary algebraic constraints, and must be able to exploit the sparsity pattern of Jacobians of large systems. We propose a custom implementation of the Krylov-Schur method, proving its robustness and its accuracy in a variety of different complex test cases.

Hydroa vacciniforme (HV) is a rare form of photosensitivity disorders in children and is frequently associated with Epstein-Barr virus (EBV) infection, whereas HV-like lymphoproliferative disorders (HVLPD) describe a spectrum of EBV-associated T-cell or NK-cell lymphoproliferations with HV-like cutaneous manifestations, including EBV-positive HV, atypical HV, and HV-like lymphoma. Classic HV occurs in childhood with vesiculopapules on sun-exposed areas, which is usually induced by sunlight and ultraviolet irradiation, and mostly resolves by early adult life. Unlike classic HV, atypical or severe HV manifests itself as recurrent papulovesicular eruptions in sun-exposed and sun-protected areas associated occasionally with facial edema, fever, lymphadenopathy, oculomucosal lesions, gastrointestinal involvement, and hepatosplenomegaly. Notably, atypical or severe HV may progress to EBV-associated systemic T-cell or natural killer (NK)-cell lymphoma after a chronic course. Although rare in the United States and Europe, atypical or severe HV and HV-like lymphoma are predominantly reported in children from Asia and Latin America with high EBV DNA levels, low numbers of NK cells, and T cell clones in the blood. In comparison with the conservative treatment used for patients with classic HV, systemic therapy such as immunomodulatory therapy is recommended as the first-line therapy for patients with atypical or severe HV. This review aims to provide an integrated, overview of current evidence and knowledge of HV and HVLPD to elucidate the pathophysiology, practical issues, environmental factors, and the impact of EBV infection.

Previous investigations have illuminated the significant association between the gut microbiome and a broad spectrum of health conditions, including obesity, diabetes, cardiovascular diseases, and psychiatric disorders. Evidence from certain studies suggests that dysbiosis of the gut microbiota may play a role in the etiology of obesity and diabetes. Moreover, it is acknowledged that dietary habits, pharmacological interventions, psychological stress, and other exogenous factors can substantially influence the gut microbial composition. For instance, a diet rich in fiber has been demonstrated to increase the population of beneficial bacteria, whereas the consumption of antibiotics can reduce these advantageous microbial communities. In light of the established correlation between the gut microbiome and various pathologies, strategically altering the gut microbial profile represents an emerging therapeutic approach. This can be accomplished through the administration of probiotics or prebiotics, which aim to refine the gut microbiota and, consequently, mitigate the manifestations of associated diseases. The present manuscript evaluates recent literature on the relationship between gut microbiota and metabolic syndrome published over the past three years and anticipates future directions in this evolving field.

Cisplatin-based chemotherapy has long been viewed as the first-line chemotherapy for advanced and metastatic urothelial carcinoma (UC). However, many patients with UC have been classified as “cisplatin-ineligible patient”, which requires alternative chemotherapy due to their poor responses. In fact, vast majority of those who initially responded to cisplatin-based chemotherapy eventually progressed. Understanding of UC tumor immunology provided an immunopathogenic bases for immune checkpoint inhibitors, targeting PD-1 and CTLA-4, to treat cisplatin ineligible metastatic UC and patients with platinum-refractory metastatic UC. In 2020, data from the trail further showed that PD-L1 inhibitors benefit prolonged survival and progression-free survival as maintenance therapy. Besides immune-targeting therapies, manipulation of tumor microenvironment via metabolic pathways alternation, such as inhibiting tumor glycolysis, lactate accumulation and exogenous glutamine uptake, has been investigated in the past few years. In this comprehensive review, we started by introducing traditional chemotherapy of UC, and summarized current evidences supporting the use of immune checkpoint inhibitors and highlighted ongoing clinical trials. Lastly, we reviewed the tumor metabolic characteristic and the anti-tumor treatments targeting metabolic pathways.

The location routing problem of unmanned aerial vehicles (UAV) in border patrol for intelligence, surveillance and reconnaissance is investigated, where the location of UAV base stations and the UAV flying routes for visiting the targets in border area are jointly optimized. The capacity of the base station and the endurance of the UAV are considered. A binary integer programming model is developed to formulate the problem, and two heuristic algorithms combined with local search strategies are designed for solving the problem. The experiment design for simulating the distribution of stations and targets in border is proposed for generating random test instances. Also, an example based on the Sino-Vietnamese border is presented to illustrate the problem and the solution approach. The performance of the two algorithms are analyzed and compared through randomly generated instances.

Railway has been used as one of the most crucial means of transportation in public mobility and economic development. For efficiently operating railways, the electrification system in railway infrastructure, which supplies electric power to trains, is essential facilities for stable train operation. Due to its important role, the electrification system needs to be rigorously and regularly inspected and managed. This paper presents a supervised learning method to classify Mobile Laser Scanning (MLS) data into ten target classes representing overhead wires, movable brackets and poles, which are recognized key objects in the electrification system. In general, the layout of railway electrification system shows a strong regularity of spatial relations among object classes. The proposed classifier is developed based on Conditional Random Field (CRF), which characterizes not only labeling homogeneity at short range, but also the layout compatibility between different object classes at long range in the probabilistic graphical model. This multi-range CRF model consists of a unary term and three pairwise contextual terms. In order to gain computational efficiency, MLS point clouds is converted into a set of line segments where the labeling process is applied. Support Vector Machine (SVM) is used as a local classifier considering only node features for producing the unary potentials of CRF model. As the short-range pairwise contextual term, Potts model is applied to enforce a local smoothness in short-range graph. While, long-range pairwise potentials are designed to enhance spatial regularities of both horizontal and vertical layouts among railway objects. We formulate two long-range pairwise potentials as the log posterior probability obtained by Naïve Bayes classifier. The directional layout compatibilities are characterized in probability look-up tables which represent co-occurrence rate of spatial relations in horizontal and vertical directions. The likelihood function is formulated by multivariate Gaussian distributions. In the proposed multi-range CRF model, the weight parameters to balance four sub-terms are estimated by applying the Stochastic Gradient Descent (SGD). The results show that the proposed multi-range CRF can effectively classify detailed railway elements, representing the average recall of 97.66% and the average precision of 97.07% for all classes.

CO2 has characteristic properties and reactions at converter smelting temperature, and the chemical reaction between CO2 and elements such as C and Si in the molten pool has bubble proliferation and cooling effects, which can effectively improve the kinetic and thermodynamic conditions of converter smelting. Here, an experimental study and industrial test on the application of CO2 in converter smelting were carried out. The smelting effects of Mode-1 and Mode-2 with total CO₂ injection amounts of 229 Nm³ and 196 Nm³, respectively, were compared, and the changes in molten steel and slag compositions, dust removal, and gas are analyzed. The test results show that converter top and bottom blowing CO₂ technology (COMI-B)technology had significant metallurgical advantages over the N-Mode; the dephosphorization rate increased by 4.2%, slag (FeO) content was reduced by 2.04%, end point nitrogen content of molten steel was reduced by 20%, gas recovery increased by 8.29 Nm³/t, and soot production reduced by 14.7%. The results of the study provide reference for the application of COMI-B technology in converters in the iron and steel industry and develop a new path for resource utilization of CO₂.

The COVID-19 pandemic halted progress in global vaccine coverage and disrupted routine childhood vaccination practices worldwide. While there is ample evidence of vaccination declines experienced during the pandemic, it is less clear how low-income countries were affected. We executed a systematic review to synthesize the current literature on impacts to routine childhood vaccinations in low-income countries from January 1, 2020 to February 8, 2023. We collected data using an extraction form on Covidence and assessed the quality of studies included in the review using the Risk of Bias in Non-Randomized Studies of Interventions (ROBINS-I) tool. Effect estimates for changes in vaccination during the pandemic were reported and summarized. Factors that influenced changes were grouped into descriptive themes. Thirteen studies, encompassing 18 low-income countries and evaluating 15 vaccines at varying doses, were included in the final review. We found that routine childhood vaccinations during the COVID-19 pandemic varied considerably by vaccine type, location, and phase of the pandemic. Nine different themes were identified as factors that influenced changes in vaccination. Documenting past experiences and lessons learned is crucial for informing preparedness efforts in anticipation of future public health emergencies. Failure to effectively address these things in the next public health emergency could result in a recurrence of declining routine childhood vaccinations.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

At present more than 9 million people die of cancer every year. Simple and broad-spectrum drugs are still an urgent need for cancer patients. Recently, we proposed a new hypothesis that intracellular osmotic pressure (IOP) is the driving force of cell division, and abnormal tumor proliferation is the result of uncontrolled IOP in cells. On the one hand, aneuploidy and abnormal function of Na⁺/K⁺ pump lead to a faster rise of IOP in tumor cell than normal cells, on the other hand, abnormality of cytoskeleton assembly leads to the decrease of tolerance limit of cell membrane (TLCM) of tumor cells for resisting IOP. This hypothesis predicts: 1)Tumor cells were more intolerant to hypotonic stress than normal cells. 2) Maligancies may be sellectively killed by a suddenn increase of IOP and combined with decrease of the TLCM of tumors. Na⁺/K⁺ pump inhibitors can promotely increase the IOP of tumor cells and cytoskeleton inhibitors can dramatically lower the TLCM of tumor cells. Therefore, Na⁺/K⁺ pump and cytoskeleton inhibitors may have a synergetic effect to kill tumor cells. 3) Molecules regulating cell osmolality may be new targets for cancer treatment.

Chromatographic separation is a critical technique in the manufacturing processes of both chemical products and biopharmaceuticals. Its principle relies on exploiting the differences in distribution between the stationary and mobile phases to achieve the separation of mixtures. The precision of substance concentration during separation directly impacts the quality and usability of the final product. Therefore, the development of an effective and precise separation control technique has long been a vital concern in the field of chromatographic separation control. Currently, the employment of Simulated Moving Bed (SMB) technology for chromatographic separation, which allows for continuous feed, has been recognized as a cutting-edge technique. SMB is a continuous process technology that enhances the efficiency of adsorbents within the bed. This sequential multi-column SMB technology not only increases production capacity but also reduces the consumption of solvents and water. It is acknowledged as one of the cleanest manufacturing technologies in the biopharmaceutical industry. However, multi-column SMB involves various variables such as flow rates in multiple sections and valve switching times, rendering its system control highly complex. Unlike traditional control objectives that aim to minimize control output errors, the control objective of SMB is to achieve a specific proportion of substance concentration. Consequently, designing and implementing traditional control theories for SMB is challenging, leading to SMB systems largely being controlled based on simple PLC controls. Moreover, these controls are often applicable only to single or a few-column SMB setups, limiting the effectiveness of high-capacity applications. To achieve effective control of SMB, this study employs an adjustable intelligent fuzzy controller with a structure like an approximate neural network (NN) for SMB control research. Simulation results demonstrate that the intelligent controller effectively achieves desirable control outcomes for the SMB system.

Aiming at the problems of high labor intensity and high cost of manual picking, high loss rate of mechanical picking seeds, low mechanization level and difficult to guarantee the quality of picking plates in the process of picking plates of edible sunflower. Based on the principle of manual plate taking, a plate taking control system for sunflower harvesting table was designed. Through the research and analysis of the principle of taking the plate of the edible sunflower harvesting table. According to the actual operation requirements, the overall scheme of the sunflower plate control system is determined, and the control strategy of imitating artificial low loss harvesting is designed. To reduce the grain loss in the process of taking the plate and improve the control accuracy of the system on the movement speed and displacement of the key components in the process of taking the plate, a trapezoidal acceleration and deceleration control algorithm is designed as the control algorithm of taking the plate. To verify the working performance of the plate control system, with the absolute error, relative error and total loss rate of the harvest as objectives. The bench and field verification experiments were both carried out. The bench experiment showed that the speed error of the plate parts was not more than 0.028 m/s. In the bench experiments of the device, the maximum positioning error was 1.25 mm, the average relative error is only 0.94 %, and the grain loss rate was not more than 2.26 %. It result showed that the system algorithm was reliable, the positioning accuracy was high, and the taking plate operation can be completed well. The field verification experiment showed that the forward speed of the unit was in the range of 0.4~0.8 m/s, and the total loss rate of harvest was less than 5 %. When the forward speed is 0.6 m/s, the minimum harvest loss rate is 2.32 %, and which indicated the control system meets the requirements of sunflower harvesting operation.

The effects of CO₂-water-rock interactions on the mechanical properties of shale are essential for estimating the possibility of sequestrating CO₂ in shale reservoirs. In this study, uniaxial compressive strength (UCS) tests together with an acoustic emission (AE) system and SEM & EDS analysis were performed to investigate the mechanical properties and microstructural changes of black shales with different saturation times (10 days, 20 days and 30 days) in water dissoluted with sub-/super-critical CO₂. According to the experimental results, the values of UCS, Young’s modulus and brittleness index decrease gradually with increasing saturation time in water with sub-/super-critical CO₂. Compared to intact samples, 30-days’ saturation causes reductions of 56.43% in UCS and 54.21% in Young’s modulus for sub-critical saturated samples, and 66.05% in UCS and 56.32% in Young’s modulus for super-critical saturated samples, respectively. The brittleness index also decreases drastically from 84.3% for intact samples to 50.9% for samples saturated in water with sub-critical CO₂, to 47.9% for samples saturated in water with super-critical carbon dioxide (SC-CO₂). SC-CO₂ causes a greater reduction of shale’s mechanical properties. The crack propagation results obtained from the AE system show that longer saturation time produces higher peak cumulative AE energy. SEM images show that many pores occur when shale samples are saturated in water with sub-/super-critical CO₂. The EDS results show that CO₂-water-rock interactions increase the percentages of C and Fe and decrease the percentages of Al and K on the surface of saturated samples when compared to intact samples.

The effect of Al or Cu content on the microstructure and mechanical properties of continuous casting and extrusion Zn alloys has been studied by room temperature tensile test, X-ray diffraction, and scanning electron microscope. With the increase of Al content, the microstructure of continuous casting and extrusion Zn alloys slightly coarsens and the lamellar eutectic structure increases. The changes in the above structural factors result in a slight decrease in strength and a significant increase in elongation of Zn-Al alloys. The strength of Zn alloys increases as the Cu content increases, due to the increased content and size of the second phase in the Zn alloys. This means that the mechanical properties of Zn alloys can be adjusted by continuous casting and extrusion process, and the improvement of equipment capacity can improve the structure and morphology of the alloys.

In this paper, the research progress on dynamic behaviors of RC structural members is reviewed from experimental, theoretical and numerical perspectives. Firstly, the basic overview, measurement methods, main conclusions and current limitations of available dynamic loading tests are presented. Then the theoretical studies on the dynamic constitutive models of RC materials, the dynamic increase factor (DIF) model for concrete and reinforcing steel and the proposed modified models of dynamic behavior parameter at the structural member level are summarized. Finally, the available modelling approach and the method for incorporating the dynamic effect in numerical simulation of RC structures are reviewed. Moreover, a brief introduction is made to the dynamic hysteretic model established on the experimental data, which provides an alternative approach to consider the dynamic effect beside the commonly used DIF method. This paper provides valuable reference for experimental studies and numerical simulations on the dynamic behaviors of RC structures, and also puts forward some issues that need to be solved in the future research works..

Blood testing is a crucial medical application. In this study, we applied Raman spectroscopy to test blood samples and obtained complete biological information, including the main components and compositions in these samples. Short-wavelength (532-nm green light) Raman scattering spectroscopy was conducted on samples of normal blood, abnormal blood in 3 types of preparation including whole blood, plasma, and serum, and the underlying information reflected by the biological characteristics detected in each sample type were analyzed. Raman spectroscopy results indicated that normal blood had high hemoglobin content, which suggests that hemoglobin is a major component of blood. Hemoglobin affects blood oxygen level. The characteristic peaks of hemoglobin were observed at 690, 989, 1015, 1182, 1233, 1315, and 1562–1649 cm−1. Analysis of plasma and serum samples indicated the presence of β-carotene, which exhibited characteristic peaks at 1013, 1172, and 1526 cm−1. In addition, surface-enhanced Raman spectroscopy was used to collect biological signals that are difficult to obtain in conventional Raman spectroscopy, including those of small molecules such as hormones, antibodies, and enzymes. Changes in biological information collected in this manner can be used as a basis for potentially diagnosing clinical diseases.

Background: The main factors to influence on the stroking performance of club head are alloy and spring-like effect. Design the structure of new club face to create the fairway wood which can show best stroking feeling and let driving distance become longer. Purpose: The club face of fairway wood is processed through the iron alloy heating procedure and CNC to innovate the club head with high spring-like effect (characteristic time). Method: (1) Use 455 stainless steel processed by heating and aging treatment, to do the analysis on microstructure and mechanical properties. (2) Through CNC to design seven different patterns for the back of club face, each pattern for three club head. The total amount is twenty-one. (3) Make finished product be test the characteristic time and the ability of strike by the practical measurement. (4) To analyze after the compare between three-way ANOVA and LSD. Results: After 455 stainless steel was heated in procedure S850℃-A550℃, mechanical properties became superior and had the better malleability, it is suitable for developing the club face of high spring-like effect. Before and after grinding among three-way ANOVA (pattern*thickness*place), did not achieve the significant level on the figure of characteristic time. Through two-way ANOVA (pattern*place and thickness*place), showed the significant deviation before and after grinding. After doing the crash test by 45m/s, all the results can reach the higher limited standard. Summary: 455 stainless steel was designed with the different club face’s thicknesses of fairway wood can make spring-like effect achieve high characteristic time. The much thinner club face let the characteristic time perform highly. But there was no obvious effects from the patterns of the back club face.

The small intestinal villus is covered with a thick layer of mucus that is secreted by goblet cells and functions primarily to first barrier from damage by toxic substance. Recent studies showed that goblet cells and mucins involved in complex immune function. Lipopolysaccharide (LPS) is widespread in the housing of livestock, which can induce bacterial infection symptoms and immunological stress within a short of time. Therefore, we aimed to study the effects of long-term exposure to different doses of LPS on intestinal mucus layer and immune barrier. The result showed that mucus layer thickness and goblet cell functions were significantly increased after low doses of LPS. The intestinal mucosal barrier can block the bacteria of the lumen, but LPS can penetrate this barrier into the blood, putting the body in a state of chronic low-grade inflammation and reducing the body’s immune function. However, after long-term exposure to high doses of LPS, a large number of lysosomes in goblet cells caused loss of function, and mucus layer thickness was significantly decreased. A large amount of LPS stuck to the mucus, leading to normal LPS and inflammatory cytokines level of plasma. The intestinal tissue morphology was damaged, and a number of immune cells were necrosis in the intestine. Collectively, long-term exposure to low doses of LPS lead to chronic low-grade inflammation in the body. Long-term exposure to high doses of LPS can be directly linked to the severity of the immunosuppression in the body.

This paper aims to present a smart high speed battery charger, powered by a photovoltaic module array, for a LiFePO4 battery as a solar energy storage device. With a battery charging strategy, the presented battery charger involves a Buck converter as the core equipped with a simple maximum power point (MPP) tracker. Considering complexity reduction and easy hardware implementation, a constant voltage MPP tracking approach is adopted such that the maximum amount of output power can be delivered to the load in response to an arbitrary change in the solar radiation. A smart two-stage charging strategy, with a constant current mode followed by a constant voltage mode, is employed in such a way that the battery charge process can be accelerated largely, while the damage caused by overcharging can be prevented. In the end, the performance of this proposal is validated experimentally.

This research seeks to advance the understanding of ecological management in the Huaihe River Basin, China. The spatiotemporal variability of the Normalized Difference Vegetation Index (NDVI) and its underlying driving forces are examined utilizing SPOT-NDVI data covering the period 2000-2019. Linear regression analysis is employed to quantify trends and assess the statistical significance of NDVI variations. A differencing approach is subsequently applied to discern the variability in NDVI. The distribution of its spatial pattern stability over 20 years is explored through the coefficient of variation. Lastly, the Geodetector method is utilized to elucidate the driving factors influencing NDVI dynamics. The results indicate that the overall NDVI is generally high, with an overall growth rate of 0.00148/year, and 2010 is identified as a significant inflection point in the trend. NDVI values are notably lower in urban areas, corresponding to urban expansion, except for regions near rivers and lakes. Land use type emerges as the strongest explanatory factor for NDVI among single factors, with climate factors exhibiting a relatively weaker degree of explanatory force. These findings suggest that the overall NDVI in the Huaihe River Basin is high, indicative of a vegetation condition that continues to improve.

Cs2NaInCl6 double perovskites, which have excellent photoelectric conversion properties and are non-toxic and lead-free, have recently attracted much attention. In particular, double perovskite quantum dots (QDs) are considered to be a promising material for optoelectronic device applications. Ligands such as oleic acid (OA) and oleylamine (OAm) are essential for the synthesis of perovskite QDs, but their roles on double perovskite QDs are not yet clear. In this study, we have investigated the binding of OA and OAm to Cs2NaInCl6 QDs through FTIR and NMR and their effects on the surface defect reduction and stability improvement for Cs2NaInCl6 QDs. We found that only OAm was bound to the QD surfaces while OA was not. The OAm has a great effect on photoluminescence quantum yield (PLQY) improvement by passivate the QD surface defects. The stability of the QDs was also investigated, and it was shown that OA played a significant role in the stability of the QDs. Our findings provide critical insights into the roles of the ligands for photophysical properties and stability of lead-free double perovskite QDs.