Influenced by geological, climatic, and natural weathering factors, the Great Wall heritage is sus-ceptible to deformations, posing significant challenges to the comprehensive preservation of the Great Wall sites. To investigate techniques for monitoring deformations in extensive linear cultural heritage sites, such as the Great Wall, this study utilizes the SBAS-InSAR technique for deformation monitoring and analysis. A dataset comprising 161 Sentinel-1A images spanning from March 2017 to January 2022 was chosen for SBAS-InSAR processing, yielding a deformation velocity field. To verify result credibility, a typical mountainous segment spanning approximately 896.53 km within the Great Wall landscape corridor underwent analysis. The findings suggest that around 75.8% of the landscape corridor along the Shanxi section of the Ming Great Wall maintain relative stability, displaying deformation rates varying from -10 to 10 mm/year. The remaining 24.2% of the land-scape corridor experiences notable deformations, including a maximum subsidence rate of 33.1 mm/year and a maximum subsidence of 148.6 mm. This study illustrates the potential utility of the SBAS-InSAR technique for monitoring and evaluating surface deformations in extensive linear cultural heritage sites.

In this paper, we establish the generalized Qi-type inequality involving conformable fractional integrals. The results presented here would provide extensions of those given in earlier works.

This paper takes the VR animation display of the Ming Xiao Mausoleum General stone statue life as an example to study the advantages of VR animation in the display of material heritage. Combined with literature and pictures, the digital restoration of the Ming Xiao Mausoleum stone statue is carried out in MAYA and Z brush, and the construction of the scene and the output of the final effect are realized in UE4.

Obstructive sleep apnea (OSA) is a common sleep disorder, and continuous positive airways pressure (CPAP) is the most effective treatment. Poor adherence is one of the major challenges in CPAP therapy. The recent boom of wearable optical sensors measuring oxygen saturation makes the at-home multiple-night CPAP titrations possible, which may essentially improve the adherence of CPAP therapy by optimizing its pressure in a real-life setting economically. We tested whether the oxygen desaturations (OD) measured in the arm muscle (arm_OD) by gold-standard frequency-domain multi-distance near-infrared spectroscopy (FDMD-NIRS) changes with titrated CPAP pressures in OSA patients together with polysomnography. We found that the arm_OD (2.08 ± 1.23%, mean ± standard deviation) was significantly smaller (P-value <0.0001) than the fingertip OD (finger_OD) (4.46 ± 2.37%) measured by polysomnography pulse oximeter. Linear mixed-effects models suggested that CPAP pressure was a significant predictor for finger_OD but not for arm_OD. Since FDMD-NIRS measures a mixture of arterial and venous OD, whereas fingertip pulse oximeter measures arterial OD, our results of no association between arm_OD and finger_OD indicate that the arm_OD mainly represented venous desaturation. Arm_OD measured by near-infrared optical sensors may be not a suitable indicator of the effectiveness of CPAP titration.

In the paper, by virtue of a Lévy–Khintchine representation and an alternative integral representation for the weighted geometric mean, the authors establish a Lévy–Khintchine representation and an alternative integral representation for the Toader–Qi mean. Moreover, the authors also collect an probabilistic interpretation and applications in engineering of the Toader–Qi mean.

Carboxypeptidase A4 (CPA4) has shown the potential possibility as a biomarker in the early diagnosis for certain cancers. However, no previous research has linked CPA4 to therapeutic or prognostic significance in bladder cancer. Using data from The Cancer Genome Atlas (TCGA) database, we set out to determine the full extent of the link between CPA4 and BLCA. We further analyzed the interacting proteins of CPA4 and infiltrated immune cells via TIMER2，STRING and GEPIA2 databases. The expression of CPA4 in tumor and normal tissues was compared using the TCGA+GETx database. The connection between CPA44 expression and clinicopathologic characteristics and overall survival (OS) was investigated using multivariate methods and Kaplan-Meier survival curves. The potential functions and pathways were investigated via gene set enrichment analysis. Furthermore, we analyze the associations between CPA4 expression and infiltrated immune cells with their respective gene marker sets using the ssGSEA, TIMER2, and GEPIA2 databases. Compared to matching normal tissues, human CPA4 was found to be substantially expressed. We confirmed that overexpression of CPA4 is linked with shorter OS, DSF, PFI, and increased diagnostic potential using Kaplan-Meier and ROC analysis. The expression of CPA4 is related to T-bet, IL12RB2, CTLA4, and LAG3, among which T-bet and IL12RB2 are Th1 marker genes, while CTLA4 and LAG3 are related to T cell exhaustion, which may be used to guide the application of checkpoint blockade and the adoption of T cell transfer therapy.

Transition metal dichalcogenides (TMDs) monolayers exhibit unique valleytronics properties due to the dependency of the coupled valley and spin state at the hexagonal corner of the first Brillouin zone. Precisely controlling valley spin-polarization via manipulating the electron population enables its application in valley-based memory or quantum technologies. This study uncovered the uncompensated spins of the antiferromagnetic oxide (NiO) serving as the ferromagnetic (FM) order to induce valley spin-polarization in molybdenum disulfide (MoS₂) monolayers via the magnetic proximity effect (MPE). A spin-resolved photoluminescence spectroscopy (SR-PL) was employed to observe MoS₂, where the spin-polarized trions appear to be responsible for the MPE, leading to a valley magnetism. Results indicate that local FM order from the uncompensated surface of NiO could successfully induce significant valley spin-polarization in MoS₂ with the depolarization temperature approximately at 100 K, which is relatively high compared to related literature. This study reveals new perspectives and potential of AFM materials in the field of exchange-coupled van der Waals heterostructures.

Following our previous success in identifying new steroid-based anticancer agents, we herein disclosed the structural requirements for retaining high potency against cancer cells and associated modes of action. The structurally novel steroidal dimer by001 inhibited growth of different esophageal cancer cells and colony formation at low micromolar levels, elevated cellular ROS levels and caused mitochondrial dysfunction. Mechanistic studies showed that by001 induced cell death through the mitochondria and death receptor-mediated apoptotic pathways and autophagy induction, as well as inhibited migration.

Due to its economic benefits and the ability to reduce carbon emissions on a large scale, the CCUS-EOR project has been widely promoted and implemented globally. By using carbon dioxide flooding, oil water transition zone reservoirs that were once considered worthless may have new potential for development because of its rich geological reserves and high quality carbon sequestration conditions. Unlike water flooded layer, the oil in the TZ is unsaturated rather than residual oil after water flooding, which would lead to special oil-water seepage law of initial oil saturation. It is necessary to clarify special oil-water seepage law of oil-water transition zone to evaluate its production & storage potential. In this paper, we present a series of experiments to characterize the relationship between residual oil saturation and initial oil saturation. Cores in four different permeability and oil in four different viscosity are used to simulate different reservoir conditions, and that CO2 immiscible flooding experiments for each cores permeability and oil viscosity are performed with four different initial oil saturation. A total of 36 sets of CO2 flooding experiment data are used to draw the initial oil saturation & residual oil saturation chart. The results show that the residual oil saturation depends on the initial oil saturation rather than constant under certain conditions of core and oil. Under the condition of low permeability and high oil viscosity, the influence of initial oil saturation on residual oil saturation is relatively strong. The initial oil saturation & residual oil saturation chart can accurately calculate the residual oil saturation, initial water cut and final recovery based on the core permeability, oil viscosity and the initial oil saturation which is the first time to put forward this kind of chart and of the great significance to evaluate the recovery potential of the TZ.

The microglia, displaying diverse phenotypes, play a significant regulatory role in the development, progression, and prognosis of Parkinson's disease. Research has established that glycolytic reprogramming serves as a critical regulator of inflammation initiation in pro-inflammatory macrophages. Furthermore, the modulation of glycolytic reprogramming has the potential to reverse the polarized state of these macrophages. Previous studies have shown that levetistilide A (LA), a phthalide component derived from Angelica sinensis, possesses a range of pharmacological effects, including anti-inflammatory, antioxidant, and neuroprotective properties. In our study, we have examined the impact of LA on inflammatory cytokines and glucose metabolism in microglia induced by lipopolysaccharide (LPS). Furthermore, we explored the effects of LA on the AMPK/mTOR pathway and assessed its neuroprotective potential both in vitro and in vivo. The findings revealed that LA notably diminished the expression of M1 pro-inflammatory factors induced by LPS in microglia, while leaving M2 anti-inflammatory factor expression unaltered. Additionally, it reduced ROS production and suppressed IκB-α phosphorylation levels as well as NF-κB p65 nuclear translocation. Notably, LA exhibited the ability to reverse microglial glucose metabolism reprogramming and modulate the phosphorylation levels of AMPK/mTOR. In vivo experiments further corroborated these findings, demonstrating that LA mitigated the death of TH-positive dopaminergic neurons and reduced microglia activation in the ventral SNpc brain region of the midbrain and the striatum. In summary, LA exhibited neuroprotective benefits by modulating the polarization state of microglia and altering glucose metabolism, highlighting its therapeutic potential.

Semi-continuous data are very common in the social science and economics. In this paper, a Bayesian variable selection procedure is developed to assess the influence of exogenous factors including observed and unobserved on the semi-continuous data. Our formulation is based on the two-part latent variable model with polytomous response. We consider two schemes for the penalties of regression coefficients and factor loadings: the Bayesian spike and slab bimodal prior and the Bayesian lasso prior. Within the Bayesian framework, we implement Markov Chains Monte Carlo sampling method to conduct posterior inference. To facilitate posterior sampling, we recast the logistic model in part one as the norm-like mixture model. Gibbs sampler is designed to draw observations from the posterior. Our empirical results show that with suitable hyper-parameters, the spike and slab bimodal method slightly outperforms the Bayesian lasso in the current analysis. Finally, a real example related to the China household finance survey is analyzed to illustrate the application of the methodology.. .

Expansion tube is ideal energy absorber which dissipates kinetic energy through plastic deformation and friction. There is an urgent need to understand the influence of key parameter, e.g. semi angle, tube material, and friction coefficient, on the mechanical response and energy absorption characteristics of expansion tube. In the present work, the material properties of the tubes were tested under quasi-static loading condition, and the numerical simulations were carried out by using commercial software ABAQUS. Based on the validated finite element simulation, all the semi angle, tube material, and friction have significant effects on the energy absorption capacity of expansion tube. The expansion tube with high tensile stress of parent material have high energy absorption capacity, while the specific energy absorption is linear with the tensile stress/density of tube material. This work would give a guidance to the structural design and parent materials selection for expansion tubes.

Taking a typical forest underlying surface as the research area, this study employed the unmanned aerial vehicle (UAV) photogrammetry to explore more accurate canopy parameters including tree height and canopy radius, which were used to improve the Noah-MP land surface model conducted in Dinghushan Forest Ecosystem Research Station (CN-Din). While the canopy radius was fitted as a Burr distribution, the canopy height of CN-Din forest followed a Weibull distribution. The replacement of the parameters by these observed UAV would result in the Noah-MP model. It was found that the influence on the simulation of the energy fluxes could not be negligible, and the main influence of these canopy parameters was on the latent heat flux which could decrease up to -11% in the midday while increase up to 15% in the nighttime. Additionally, this work indicated that the description of the canopy characteristics for the land surface model should be improved to accurately deliver the heterogeneity for the underlying surface.

Agriculture is an industry that heavily relies on the environment. The increasing frequency of ex-treme disasters attributable to climate change has adversely affected agricultural land and dis-rupted the stability of the supply of agricultural products. Therefore, we implemented a research program focused on current strategies for adapting to agricultural meteorological disasters. The primary goal was to actively promote disaster prevention information and techniques through information platforms and applications and to provide refined forecasting and an early warning system to enhance preparedness for and recovery from agricultural disasters. This initiative can transform passive mitigation into dynamic action by disseminating crucial information to farmers. We integrated meteorological data and crop characteristics to develop disaster prevention strate-gies for the predisaster, during-disaster, and postdisaster stages to empower farmers to implement autonomous disaster prevention, ensuring their profitability and minimizing the impact of disas-ters. This paper presents an agricultural disaster prevention system involving cross-disciplinary collaboration to establish an early warning system for crop disasters. However, the effectiveness of the early warning system relies on the availability of complete meteorological and crop infor-mation, necessitating high-density agricultural meteorological stations, refined weather forecast services, historical crop damage data, and ongoing research and development on disaster preven-tion technology. In the system, a diversified social media interface is used to provide local farmers with weather forecast information. When impending disasters are identified, the platform acti-vates disaster prevention measures to reduce agricultural losses. This article paper introduces Taiwan’s agricultural disaster prevention system as a complete disaster prevention strategy.

Pluripotent stem cells (PSCs) can differentiate into three germ layers and diverse autolo-gous cell lines. Being among the most commonly used large domesticated hoofed animals and serving as a vital source of food and bioreactors, cattle are among the many species in which PSCs have been developed. Bovine PSCs (bPSCs) are the "seed cells" of regenerative science and have immense potential to advance species propagation, genetic engineering, and disease treatment. Moreover, they can aid in screening new drugs for efficacy and toxicity, model human diseases, and establish a sustainable agricultural system that can cater to the needs of the growing global population. Establishing stable bPSCs in vitro has been a critical scientific challenge, and researchers have made numerous attempts to address this issue. This review primarily delves into the current research progress of bPSCs, the challenges faced, and their potential applications.

The article presents a literature review of three Chinese manuscripts containing natural dyes recipes and three containing synthetic dyes from the Ming Dynasty to the Republican Period. The manuscripts mentioned were exclusively used as references and sources. Four databases were used to access the original documents, then, a translation from old mandarin to Spanish was made. For natural dyes, the results show four dyestuffs were commonly used to produce colors, sappanwood (Caesalpinia sappan L.), followed by safflower (Carthamus tinctorius L.), indigo (Indigofera tinctoria L.), and sophora (S. japonicum L.). While the synthetic dyes exported to or produced in China were mainly bluish, greenish, and violet probably because they were difficult to obtain from natural ones. The literature review of the dyes and their recipes can be a key factor in any art history or conservation study, improving the understanding of how the colors were achieved and as complementary information for analytical analyses. It provides useful details that contribute to the preservation of Chinese dye history on silk heritage.

The present study analyzed light emitting diodes (LEDs) as an output load and used a Taylor series to describe the characteristic curve based on the exponential characteristic of voltage and current. A prototype circuit of a flyback LED driver system was established to verify whether the theory is consistent with actual results. This study focused on the exponential relationship of LED voltage and current. Conventional simulations usually used linear models to present LED loads. However, the linear model resulted in considerable error between simulation and actual characteristics. Therefore, this study employed a Taylor series to describe the nonlinear characteristic of an LED load. Through precise calculations with Mathcad computation software, the error was effectively reduced. Moreover, the process clarified the influence of temperature on LEDs, which benefited the characteristic analysis of the entire system. Finally, a realized circuit of 120-W flyback LED drivers was established for conducting theory verification, including theoretic analysis and evaluation of the system design process of the flyback converter. The circuit simulation software SIMPLIS was used to demonstrate the system model, which enabled quick understanding of the system framework established in this study. Regarding LEDs, a commercially available aluminum luminaire was used as the output load. The measured results of the actual circuit and the simulation results were remarkably consistent. For the same system at the same temperature, the error between the simulation and actual results was less than 3%, which proved the reliability of the Taylor series simulation.

In the paper, the author introduces the notions "multi-order logarithmic numbers" and "multi-order logarithmic polynomials", establishes an explicit formula, an identity, and two recurrence relations by virtue of the Faa di Bruno formula and two identities of the Bell polynomials of the second kind in terms of the Stirling numbers of the fi rst and second kinds, and constructs some determinantal inequalities, product inequalities, logarithmic convexity for multi-order logarithmic numbers and polynomials by virtue of some properties of completely monotonic functions.

Multicellular organisms organize themselves according to two principles; first, the equilibrium between the driving force of unstable state cells and apoptosis or senescence; and second, the mutual equilibrium between the functional requirements of different types of cells. For the first principle, we deduce that stem cells at different levels have their own growth limits, which are determined by two factors: the ability of the stem cells to enter an unstable state (specifically, the ability of cells to divide and differentiate); and the rate of cellular senescence, loss of function, and finally, apoptosis. The superposition of stem cell limits at different levels over each other can amplify small differences at the genetic level. Moreover, the growth limits of different organs are different, which lead to different individuals having completely different appearances. The second principle is that the sum of the specific output functions of an organ must be equal to the overall demand for the function to be provided by the organ. If negative entropy input can meet this equilibrium, defects in certain genes will cause these defective individuals to become larger or develop other morphology.

Abstract: NFinFET transistors with fin channel length 90nm and a planar MOSFET transistor with channel length 180nm and 90nm are presented with characteristic curves at various gate biases. A finalized algorithm with kink effects is effectively responsible for addressing the field effect transistors. The algorithm includes the modified conventional current-voltage formula and a nonlinear heat-associated kink solution which is simplified as a Gaussian form. Three parameters in modified model includes kN (related with channel width, channel length, and gate oxide capacitor, and proportional to the mobility of carriers)Vth(Threshold Voltage), and (the inverse of Early Voltage). Those parameters are determined to minimize the discrepancies between the measured data and the fitting values, but leave kinks located at around (VGS－Vth), which are deliberately eliminated by the Gaussian form because of the agitation of thermal kink effects. The whole fitting is made to be as close as the as-measured IDS-VDS. In the mean time, those determined parameters are physically meaningful after the analysis has been done.

Aiming at the problems of inaccurate segmentation of long object and information loss of small object in real-time semantic segmentation algorithm, this paper proposes a lightweight multi-branch real-time semantic segmentation network based on BiseNetV2. The new auxiliary branch makes full use of spatial details and context information to cover the long object in the field of view. Meanwhile, in order to ensure the inference speed of the model, the asymmetric convolution is used in each stage of the auxiliary branch to design a structure with low computational complexity. In the multi-branch fusion stage, the alignment and fusion module is designed to provide guidance information for deep and shallow feature mapping, so as to make up for the problem of feature misalignment in the fusion of information at different scales, and thus reduce the loss of small target information. In order to further improve the model’s awareness of key information, a global context module is designed to capture the most important features in the input data. The proposed network uses NVIDIA GeForce RTX 3080 Laptop GPU experiment, on the road street view data set Cityscapes and CamVid average occurring simultaneously ratio reached 77.1% and 78.4% respectively, with running speed of 127 frames/s respectively and 112 frames/s. The experimental results show that the proposed algorithm can achieve real-time segmentation and improve the accuracy significantly, showing good semantic segmentation performance

Gut microbiota dysfunction is a key factor affecting chronic kidney disease (CKD) susceptibility. Puerariae Lobatae Radix (PLR), a traditional Chinese medicine and food homologous herb, is known to promote gut microbiota homeostasis, however, its role in renoprotection remains unknown. This study aimed to investigate the efficacy and potential mechanism of PLR to alleviate CKD. An 8-week 2% NaCl-feeding murine model was applied to induce CKD and evaluate the therapeutic effect of PLR supplementary. After gavage for 8 weeks, PLR significantly alleviated CKD-associated creatinine, urine protein increasement and nephritic histopathological injury. Moreover, PLR protected kidney from fibrosis by reducing inflammatory response and down-regulating the canonical Wnt / β-catenin pathway. Further, PLR rescued gut microbiota dysbiosis and protected high salt-induced gut barrier dysfunction. We found enrichment of Akkermansia and Bifidobacterium after PLR intervention, the relative abundance of which were in positive correlation with normal maintenance of renal histology and function. Next, fecal microbiota transplantation experiment verified that the positive effect of PLR on CKD was at least partially exerted through gut microbiota reestablishment and down-regulation of the Wnt / β-catenin pathway. Our study provides evidence for new function of PLR on kidney protection and put forward a potential therapeutic strategy target for CKD.

This paper studies the integrated design problems of control and guidance with parameter uncertainties, target disturbances, input constraints and actuator faults. Firstly, based on the integrated design idea of the missile guidance and control, the auxiliary variable is used to establish and transform it into a cascade system with input constraints, actuator faults and disturbances of unknown upper bounds. Secondly, the adaptive anti-saturation dynamic surface fault-tolerant controller is designed by using the back-stepping method, adaptive control, auxiliary system and tracking differentiator. By introducing the tracking differentiator and tangent barrier Lyapunov function, the computational explosion problem in the traditional back-stepping method is avoided and the angle of attack can be guaranteed in prospective range, respectively. Finally, the theoretical proof of the designed control strategy is given to ensure that the states of the closed-loop system are bounded. At the same time, the digital simulation of the maneuvering target of different maneuvering forms is carried out, which further illustrate the effectiveness and robustness of the designed control schemes.

Background: Constipation is one of the chronic gastrointestinal functional diseases that affects the quality of life. While Qi Lang Formula (QLF) has demonstrated effectiveness in alleviating constipation symptoms, its precise mechanism remains elusive. Methods: QLF was analyzed using UPLC-MS/MS. Targets for QLF were collected from SwissADME, Herb, ITCM databases, and FC-related targets from scRNA-seq and Genecards databases. Overlapping targets suggested potential QLF therapy targets for FC. Enrichment analysis used the KOBAS database. A "drug-ingredient-target" network was constructed with Cytoscape, and AutoDock verified active component binding. H&E staining assessed colonic mucosa changes, TEM examined ICC structural changes. ELISA measured neurotransmitter levels, and western blot verified QLF's effect on target proteins. ICC proliferation was observed through immunofluorescence. Results: We identified 89 targets of QLF associated with ICC-related FC, with c-Kit emerging as the pivotal target. Molecular docking studies revealed that Atractylenolide Ⅲ, Apigenin, Formononetin, Isorhamnetin, Naringenin, and Ononin exhibited strong binding affinities for the c-Kit structural domain. QLF significantly enhanced first stool passage time, fecal frequency, fecal moisture content, and intestinal propulsion rate. Further analysis unveiled that QLF not only restored neurotransmitter levels but also mitigated colon muscular fiber ruptures. ICC ultrastructure exhibited partial recovery, while RT-qPCR and western blot confirmed upregulated c-Kit expression and downstream targets. Immunofluorescence results indicated ICC proliferation post QLF treatment in rat colon. Conclusion: Our findings suggest that QLF may promote ICC proliferation by targeting SCF/c-Kit and its downstream signaling pathway, thereby regulating intestinal motility.

Lignin is insoluble in water, limiting its use in the synthesis of adhesives. Therefore, in order to increase the amount of lignin raw materials used in the synthesis of adhesives, a kind of aminated lignin compounds was prepared through lignin amination reaction, and conducting structural analysis in this paper. The particle size of the amino lignin is about 100 nm, with the weight average molecular weight of 57,627 g/mol and a water solubility of 0.45g/100ml. The reaction mechanisms were proposed that the phenolic hydroxyl groups of lignin react with ammonia molecules, and thereby successfully introducing amino groups to generate the aminated lignin compounds. Therefore, this article enriches the scientific theory of lignin reactions and provides reference for the widespread application of lignin raw materials in the field of adhesives.

In the paper, the author finds bounds of the sine and cosine along a circle on the complex plane in terms of two double inequalities for the norms of the sine and cosine along a circle on the complex plane.

Currently the rapid growth of global economy has the competition among high-tech industries develop from regional to global, and the competition becomes fierce. In face of such fierce competition in global high-tech industry, it is realized that tangible assets could no longer be the differentiation basis, but intangible assets are regarded as the differentiation capital. An enterprise with sustainable innovation would dominate the world market and enhance the international competitiveness of domestic economy. When internal entrepreneurial culture is prevalent, an enterprise would naturally promote the innovation capability. Such a point of view also explains more popular of the innovative products or services of some enterprises than those with larger scales. Aiming at employees in high-tech industry in Guanxi Province, total 500 copies of questionnaire are randomly distributed, and 337 valid copies are retrieved, with the retrieval rate 67%. The research results reveal significantly positive correlations between 1.entrepreneurial culture and sustainable innovation capability, 2.sustainable innovation capability and patent, and 3.entrepreneurial culture and patent. According to the results, suggestions are proposed, expecting to explain how a high-tech business outperforms in the changeable digital era and acquires the sustainable innovation capability and patent to grasp the opportunity.

In the paper, the author discusses and computes bounds of the sine and cosine along straight lines on the complex plane.

The bridge crane is often used in a complex environment, often subject to interference of all loads. Some uncertainties factors often have an inevitable impact on its swing. So the force situation of the bridge crane during a working cycle is analyzed, and a three-dimensional dynamic mathematical model of the bridge crane is built. Through the simulation analysis of the model under the action of driving force and wind load, the change law of the swing angle of the bridge crane is studied. Then, the fuzzy control theory is used to determine the control parameter in the anti sway control process. The position, swing angle deviation and deviation rate of the bridge crane are taken as the input, and the parameter correction is obtained after the fuzzification by using the center of gravity method, the anti sway fuzzy control system of the bridge crane is designed and simulated. The research results show that the fuzzy PID anti sway controller can not only improve the adaptability of the control system, but also overcome the large overshoot, quickly restrain the swing, and effectively realize the anti sway function of the bridge crane.

In the paper, by convolution theorem for the Laplace transforms and analytic techniques, the author finds necessary and sufficient conditions for complete monotonicity, monotonicity, and inequalities of several functions involving polygamma functions. By these results, the author derives a lower bound of a function related to the sectional curvature of the manifold of the beta distributions. Finally, the author poses several guesses and open problems related to monotonicity, complete monotonicity, and inequalities of several functions involving polygamma functions.

Elderly individuals frequently perceive companion robots devoid of warmth, resulting in a reluctance to accept these robots' services. This perception has become a significant barrier to the introduction of companion robots into households. To address this issue, this study employs KE methods to translate the elderly's need for warmth perception from companion robots into elements of modelling design. Initially, 20 pairs of affective words and 22 sample images of companion robots were chosen. The "rational-emotional" and "dim-bright" dimensions were identified as positively influencing the elderly's warmth perception of companion robots through SD method analysis. Subsequently, a hierarchical analysis table was established, with warmth perception as the root layer, modelling style and color matching as the basic layer, "rational-emotional" and "dim-bright" as the expansion layer, and the eight characteristic elements of companion robots as the morphological layer. The link between affective imagery and design elements was then established from the sample robots with higher warmth perception scores. Based on the correlation between the two, various design schemes were formed through random combinations. Finally, the design schemes were evaluated using the warmth perception scale, and the warmth perception scores of each sample model were obtained. This research provides design references for designing companion robots for the elderly with a "sense of warmth".

Using lightweight fire-rated board (LFRB) presents cost-effective opportunities for various passive fire protection measures. The aim of the project is to develop a LFRB with enhanced fire resistance, acoustic properties, and mechanical properties. These properties were determined using the Bunsen burner, furnace, energy dispersive X-Ray, impedance tube instrument, and Instron universal testing machine. To fabricate the LFRBs, vermiculite and perlite were blended with flame-retardant bind-ers, and four types of LFRBs were produced. A fire test was conducted to compare the fire-resistance performance of the LFRBs with a commercially available flame retardant board. The B2 prototype showed exceptional fire-resistant properties, with a temperature reduction of up to 73.0 °C as compared to the commercially available fire-rated magnesium board. Incorporating nano chicken eggshell into the specially formulated flame-retardant binder preserved the LFRBs’ structural integrity, enabling them to withstand fire for up to 120 minutes with an equilibrium temperature of 92.6 °C. This approach also provided an absorption coefficient of α = 2.0, a high flexural strength of 3.54 MPa, and effective flame retardancy properties with a low oxygen/carbon ratio of 2.60. These results make the LFRBs valuable for passive fire protection applications in the construction and building materials industry.

The continuous casting process of helical fiber reinforced metal matrix composites was proposed, and the experimental equipment was designed and manufactured. The relationship model be-tween the process parameters and the helical shape of the fibers in the metal matrix is analyzed by differential geometry. Helical carbon fiber reinforced lead matrix composites were prepared under different conditions. When the melting temperature and cooling intensity were increased, the helical radius of helical carbon fiber in lead matrix was increased. When the fiber rotation speed was increased, the helical radius was decreased, and the helical pitch was de-creased proportionally. The experimental results are consistent with the process model. Carbon fiber rein-forced aluminum composites were prepared. Scanning electron microscopy showed that the infiltration between the aluminum matrix and the carbon fiber was not complete. As the volume fraction of carbon fiber which was added in composites is too small, the mechanical properties of the composites have not been significantly improved.

Nutrients are the driving force of plant and herbivore interactions. Different elements and fertilization levels in soil, or artificially fertilized substrates can have a direct impact on plant defense responses. Meanwhile, nutrient levels mediated by root associated microbes can indirectly affect plant-herbivore interactions. Nutrient uptake promoted by beneficial mycorrhizal fungi or rhizobacteria interacting with roots can stimulate plant tolerance to herbivore attack, as evidenced by herbivore performance, plant nutrient status, plant biomass allocation and compensatory growth. In return, herbivory affects nutrient fluxes between plants and their associated beneficial microbes. Furthermore, aboveground and belowground herbivory can affect the nutrient exchange between plants and soil microbial communities, mainly for carbon-and nitrogen-based resources supporting herbivores´ life cycles. These ecological interactions are governed by jasmonic acid (JA) and key enzymes on the molecular level. This review summarizes the current scientific literature on the role of nutrients in plant-herbivore interactions. This will support efforts to optimize plant defense strategy via managing nutrient variance.

Over the past decades, overweight and obesity has become a global epidemic and the leading threat for death. To prevent the serious risk, an overweight or obese individual must apply a long-term weight-management strategy to control food intake and physical activities, which is however, not easy. Recently, with the advances of information technology, more and more people can use wearable devices and smartphones to obtain physical activity information, while they can also access various health-related information from Internet online social networks (OSNs). Nevertheless, there is a lack of an integrated approach that can combine these two methods in an efficient way. In this paper, we address this issue and propose a novel mobile-social framework for health recognition and recommendation, namely, H-Rec². The main ideas of H-Rec² include (1) to recognize the individual's health status using smartphone as a general platform, and (2) to recommend physical activity and food intake based on personal health information, life science principles, and health-related information obtained from OSNs. To demonstrate the potentials of the H-Rec² framework, we develop a prototype that consists of four important components: (1) an activity recognition module that senses physical activity using accelerometer, (2) a health status modeling module that applies a novel algorithm to generate personalized health status index, (3) a restaurant information collection module that collects relevant information from OSN, and (4) a restaurant recommendation module that provides personalized and context-aware recommendation. To evaluate the prototype, we conduct both objective and subjective experiments, which confirm the performance and effectiveness of the proposed system.

Spermatogonial stem cells (SSCs) are the only primitive spermatogonial cells in males that can naturally transmit genetic information to their offspring and replicate throughout their lives. Phospholipase D family member 6 (PLD6) has recently been found to be a surface marker for SSCs in mice and boars; however, it has not been validated in cattle. The results of RT-PCR and qRT-PCR found that the relative expression of PLD6 gene in the testicular tissues of 2-year-old Simmental calves was significantly higher than that of 6-month-old calves. Immunofluorescent staining further verified the expression of PLD6 protein in bovine spermatogenic cells like germ cell marker VASA. Based on multiple bioinformatic databases, PLD6 is a conservative protein which has high homology with mouse Q5SWZ9 protein. It is closely involved in the normal functioning of the reproductive system. Molecular dynamics simulation analyzed the binding of PLD6 as a phospholipase to cardiolipin (CL), and PLD6-CL complex showed high stability. The protein interaction network analysis showed that there is a significant relationship between PLD6 and piRNA binding protein. PLD6 acts as an endonuclease and participates in piRNA production. In addition, PLD6 in bovine and mouse testes has a similar expression pattern with the spermatogonium-related genes VASA and PIWIL2. In conclusion, these analyses imply that PLD6 has a relatively high expression in bovine testes and could be used as a biomarker for spermatogenic cells including SSCs.

Tack is one of the most important factors affecting the operability of prepregs, but it is still very difficult to obtain the change of prepreg tack with time at different temperatures. In this paper, a newly designed T-peel device is used to test the tack decay rate of prepregs at different temperatures. The obtained decay rate deviates less than 8.9% from the manufacturer's data. The maximum deviation of the ratio of tack decay speeds calculated by the Arrhenius equation from the experiments is not higher than -9.7%. It is proved that the present method can obtain the decay rate of tack of prepregs at different temperatures. This method is also applicable to the other two types of prepregs. The article proposes the handling life unit, an operational life measurement unit for prepregs, and establishes that the relationship between tack and remaining shelf life reduces prepreg management costs.

A case-crossover study examined how PM_2.5 from Asian Dust Storms (ADS) affects the number of emergency room (ER) admissions for cardiovascular diseases (CVDs) and respiratory diseases (RDs). Our data indicated that PM_2.5 concentration from ADS was highly correlated with ER visits for CVDs and RDs. The odds ratios (OR) increased by 2.92 (95% CI: 1.22-5.08) and 1.86 (95% CI: 1.30-2.91) per increase 10 µg/m³ in PM_2.5 levels, for CVDs and RDs, respectively. A 10 µg/m³ increase in PM_2.5 from ADSs was significantly associated with increase in ER visits for CVDs among those 65 years of age and older (an increase of 2.77 in OR) and for females (an increase of 3.09 in OR). In contrast, PM_2.5 levels had a significant impact on RD ER visits among those under 65 years of age (OR=1.77). The risk of ER visits for CVDs increased on the day when the ADS occurred in Taiwan and the day after (lag 0 and lag 1); the corresponding risk increase for RDs only increased on the fifth day after the ADS (lag 5). In Taiwan’s late winter and spring, the severity of ER visits for CVDs and RDs increases. Environmental protection agencies should employ an early warning system for ADS to reduce high-risk groups’ exposure to PM_2.5.

Spectacular shifts have been led to by The COVID-19 crisis in consumer behavior. Retailers will have to work hard to meet ever-evolving customer service experience with respect to the ways in which it may be differently affected by offline or online transactions in order to win and stay relevant. We suggest an integrative framework and construct customer service experience hypotheses, based on its antecedents and consequences that will contribute to academic study as well as managerial implications. The hypotheses are tested by a simultaneous equation model employing two data sets of the retail industry's offline and online customers. In this study, 571 samples of these businesses, 319 and 252 respondents from offline and online retail channels, respectively, were collected by means of an online web survey of consumers. The results show that the impact of consequences and antecedents of CSX differs based on the media utilized. The integrative framework of CSX in its online medium is far more effective than its explanatory power offline. The outcomes are reasonably counterintuitive in so far as they demonstrate that while most elements of CSX where a service is selected offline is the same in terms of customer loyalty and value equity, the emotional element related to the service provider is higher when the service is selected offline rather than online. These outcomes indicate that, contrary to popular fears, the online medium enables firms to develop a loyal customer foundation. These findings offer perceptivity into how an online channel could be used to better complement the offline channel, contributing towards new knowledge and understanding on CSX and how it may be utilized for managerial decision-making.

It is desirable to upgrade previous evolutionary theories, which have remained incomplete and controversial for decades. Here we employ the concept of carbon-based entities (CBEs), which include methane, amino acids, proteins, organisms, and other entities containing relatively many carbon atoms. We deduce the driving force, mechanisms, steps, modes, tempos of CBE evolution, through integration of biology, physics, and chemistry using logics for complex issues. We hence establish the Carbon-Based Evolutionary Theory (CBET). The CBET suggests that evolution is the increase in hierarchy, diversity, fitness of CBEs under natural selection and driven by thermodynamics due to the chemical effect of the thermodynamic features of the Earth on CBEs. It provides better explanations for life origin, macroevolution events, natural selection, sympatric speciation, and evolution tempos than previous evolutionary theories. It reveals the evolutionary basis of multiple important social notions, including diversity, collaboration, altruism, obeying rules, and proper increase in freedom. It refutes some wrong notions in thermodynamics, including negative entropy (negentropy) and that biological order is equal to thermodynamic order, which have misled many people. The CBET is supported by its deduction and application. It could be a rare bridge linking laws of thermodynamics, evolution of life, and development of human society, and could have great significance in various sciences.

This paper reports the efforts made and experiences gained in developing the Flood Prevention and Emergency Response System (FPERS) powered by Google Earth Engine, with focus on its applications at the three stages of floods. At the post-flood stage, FPERS integrates various remote sensing imageries, including Formosat-2 optical imagery, to detect and monitor barrier lakes, synthetic aperture radar imagery to derive an inundation map, and high-spatial-resolution photographs taken by unmanned aerial vehicles to evaluate damage to river channels and structures. At the pre-flood stage, a huge amount of geospatial data are integrated in FPERS and are categorized as typhoon forecast and archive, disaster prevention and warning, disaster events and analysis, or basic data and layers. At the during-flood stage, three strategies are implemented to facilitate the access of the real-time data: presenting the key information, making a sound recommendation, and supporting the decision-making. The example of Typhoon Soudelor in August of 2015 is used to demonstrate how FPERS was employed to support the work of flood prevention and emergency response from 2013 to 2016. The capability of switching among different topographic models and the flexibility of managing and searching data through a geospatial database are also explained, and suggestions are made for future works.

In the paper, the authors survey integral representations (including the Lévy--Khintchine representations) and applications of some bivariate means (including the logarithmic mean, the identric mean, Stolarsky's mean, the harmonic mean, the (weighted) geometric means and their reciprocals, and the Toader--Qi mean) and the multivariate (weighted) geometric means and their reciprocals, derive integral representations of bivariate complex geometric mean and its reciprocal, and apply these newly-derived integral representations to establish integral representations of Heronian mean of power 2 and its reciprocal.

In the present work, a predictive modelling and optimization with the adaptive network based fuzzy inference system(ANFIS) modelling of mechanical properties of laser-coated NB/SiC/Ni welds was studied based on Taguchi design by laser cladding. An ANFIS model based on a Sugeno type fuzzy inference system was developed for predicting the hardness properties of SiC/BN/Ni welds by laser cladding with experimental data required for network training and prediction. Based on analysis of variance, three important factors were taken as inputs for the fuzzy logic inferences, while the hardness properties was taken as the output of the ANFIS. The microstructure of welds were analysed using scanning electron microscopy with an energy dispersive X-Ray spectrometer. Highly developed leaf-like dendrites and eutectic crystals were found in some areas of the melting zone for the BN/SiC/Ni weld, which was significantly hardened. The ANFIS model based on Taguchi's design provides a better pattern of response because the predicted and experimental values were highly similar. As a result, a satisfactory result was achieved between the predicted and experimental values of hardness in laser-coated NB/SiC/Ni welds, whereby the success and validity of the method was verified.

The main purpose of this paper is to present a comprehensive view of the application mathematical models in the designing and implementing SSCM beside to solving problems and making decision. The research questions are: what mathematical models are used for designing and implementing sustainable supply chain management, how to use them, which industries implemented in, what modules of SSCM depth in and finally finding the gaps of researches. The methodology of research is Systematic Literature review through peer review papers which are published in high ranking journals. In this paper, First, we search all papers through scientific data bases like Scopus, science direct, MDPI, Springer, Google Scholar, then, screening papers based on the criteria such as subject of paper, journals impact factor which is published in-should be peer review journal- and relative content of the papers. Finally, we selected 245 papers with three steps screening through 2806 papers that they have enough quality and relative to our research goals for context analysis. Through context analysis, first we categorized the information of the papers and drew the current situation of researches in the framework of our topic. Then, we evaluate and compare the goals of sustainability and current situation and found the gapes, then, offered new suggestions like implementing SSCMs models in pollutant industries like casting industry, Heavy industry, coal Industry and so on. On the other hand, there are gaps in researches in some modules of SSCM such as packaging, designing products, etc.

In the paper, the authors survey integral representations of the Catalan numbers and the Catalan–Qi function, discuss equivalent relations between these integral representations, supply alternative and new proofs of several integral representations, collect applications of some integral representations, and present sums of several power series whose coefficients involve the Catalan numbers.

In recent years, many algorithms based on end-to-end deep networks have been proposed to deal with the target detection problem of videos. However, the deep network models usually consume a lot of computing resources during the procedure of analysis of videos with complex dynamic backgrounds. In this paper, a new method of object detection based on information theory is presented. Firstly, each frame in a video is converted into an effective information map by using the Harris corner detection method. Secondly, the sensitive areas in the frame are extracted by using the context information and the effective information maps of the consecutive video frames. The sensitive areas in the video frame are the candidate areas where the target objects would be appeared at high probabilities. Thirdly, the information entropy features of each sensitive area are extracted to form the feature matrix, based on which, an SVM model is trained for selecting the target areas from the sensitive areas. Finally, the locations of the objects are detected based on the target areas in the video with a complex dynamic background. As a lightweight video detection framework, the method presented in this paper can save a lot of computing resources. Experimental results show that this method can achieve good results in the benchmark of CDnet 2014.

In the paper, the authors find two explicit formulas and recover a recursive formula for the generalized Motzkin numbers. Consequently, the authors deduce two explicit formulas and a recursive formula for the Motzkin numbers, the Catalan numbers, and the restricted hexagonal numbers respectively.

In the paper, by virtue of convolution theorem for the Laplace transforms, Bernstein's theorem for completely monotonic functions, and other techniques, the author finds necessary and sufficient conditions for a difference constituted by four derivatives of a function involving trigamma function to be completely monotonic.

In the paper, by induction and recursively, the author proves that the generating function of multivariate logarithmic polynomials and its reciprocal are a Bernstein function and a completely monotonic function respectively, establishes a Lévy-Khintchine representation for the generating function of multivariate logarithmic polynomials, deduces an integral representation for multivariate logarithmic polynomials, presents an integral representation for the reciprocal of the generating function of multivariate logarithmic polynomials, computes real and imaginary parts for the generating function of multivariate logarithmic polynomials, derives two integral formulas, and denies the uniform convergence of a known integral representation for Bernstein functions.

In the paper, by virtue of some properties for the Riemann zeta function, the author finds a double inequality for the ratio of two consecutive Bernoulli numbers with even indexes and analyzes the approximating accuracy of the double inequality.

In the paper, the author (1) presents an explicit formula and its inversion formula for higher order derivatives of generating functions of the Bell polynomials, with the help of the Faà di Bruno formula, properties of the Bell polynomials of the second kind, and the inversion theorem for the Stirling numbers of the first and second kinds; (2) recovers an explicit formula and its inversion formula for the Bell polynomials in terms of the Stirling numbers of the first and second kinds, with the aid of the above explicit formula and its inversion formula for higher order derivatives of generating functions of the Bell polynomials; (3) constructs some determinantal and product inequalities and deduces the logarithmic convexity of the Bell polynomials, with the assistance of the complete monotonicity of generating functions of the Bell polynomials. These inequalities are main results of the paper.

Gastric inflammation-related disorders are commonly observed digestive system illnesses char-acterized by the activation of proinflammatory cytokines, particularly tumor necrosis factor-α (TNF-α). This results in the induction of cyclooxygenase-2 (COX-2)/prostaglandin E2 (PEG2) and matrix metallopeptidase-9 (MMP-9). These factors contribute to the pathogenesis of gastric in-flammation disorders. We examined the preventive effects of Lonicera japonica Thunb. ethanol ex-tract (Lj-EtOH) on gastric inflammation induced by TNF-α in normal GES-1 cells. The GES-1 cell line was used to establish a model that simulated the overexpression of COX-2/PGE2 and MMP-9 proteins induced by TNF-α, to examine the anti-inflammatory properties of Lj extracts. The re-sults indicated that Lj-EtOH exhibits significant inhibitory effects on COX-2/PEG2 and MMP-9 ac-tivity, attenuates cell migration, and provides protection against TNF-α-induced gastric inflam-mation. The protective effects of Lj-EtOH are associated with the modulation of COX-2/PEG2 and MMP-9 through activation of TNFR–ERK 1/2 signaling pathways as well as the involvement of c-Fos and nuclear factor kappa B (NF-κB) signaling pathways. Based on our findings, Lj-EtOH ex-hibits a preventive effect on human gastric epithelial cells. Consequently, it may represent a novel treatment for the management of gastric inflammation.

The three-phase separator was perforated after four years’ service. The perforation position is at the bottom of the vessel under the baffle plate in an oil transfer station. The cause of perforation was investigated by chemical analysis using a direct-reading spectrometer, microstructure examined by optical microscope(OM), and lab simulated corrosion experiments by electrochemical workstation, and the corrosion products examined with scanning electron microscopy(SEM), energy dispersive spectrometer(EDS) in this paper. The analyses indicated that the coating at the base of the pressure vessel failed and this led to the direct exposure of the carbon steel plate to the corrosive medium. The electrical contact between the carbon steel and the stainless steel, sets up a galvanic cell that accelerated the corrosion of the pressure vessel which eventually led leads to the perforation.

With the advancement of the economy and society, policymakers acknowledge the significance of improving rural households' well-being as a crucial factor in promoting sustainable economic and social development. Based on the matching data of China Household Finance Survey and Digital Rural County Index, this study empirically examines the effect and mechanisms of digital village construction on subjective well-being of rural households. The results revealed that digital village construction has a significant improvement in their subjective well-being. The impact of digital village construction is particularly significant in rural areas located in the western regions of China, as well as among households possessing higher levels of human capital. The process through which digital village construction enhances the subjective well-being of rural households involves the augmentation of household income, the promotion of non-farm employment opportunities, and the enhancement of rural governance. This study provides robust micro-empirical evidence highlighting the positive welfare effects of digital rural construction. This study provides insights into the digital village construction within the happiness economy framework, offering a new perspective. The imperative to strengthen rural digital infrastructure and improve farmers' proficiency in modern information skills is a strategic policy aimed at enhancing well-being of rural households.

A Mw7.8 earthquake struck Turkey on February 6, 2023, causing severe casualties and economic losses. This paper investigates the characteristics of strong ground motion and seismogenic fault of the earthquake. We collected and processed the strong ground motion records of 379 stations using Matlab, SeismoSignal and Surfer software, and obtained the peak ground acceleration (PGA) contour map. We analyzed the near-fault effect, the fault locking segment effect and the trampoline effect of the earthquake based on the spatial distribution of PGA, the fault geometry and slip distribution. We found that the earthquake generated a very strong ground motion concentration effect in the near-fault area, with the maximum PGA exceeding 2000cm/s2. However, the presence of fault locking segments influenced the spatial distribution of ground motion, resulting in four significant PGA high-value concentration areas at a local dislocation, a turning point and the end of the East Anatolian Fault. We also revealed for the first time the typical manifestation of the trampoline effect in this earthquake, which was characterized by a large vertical acceleration with the positive direction significantly larger than the negative direction. This paper provides an important reference for understanding the seismogenic mechanism, damage mode, characteristics and strong earthquake law of Turkey earthquake.

In the paper, the authors establish two identities to express the generating function of the Chebyshev polynomials of the second kind and its higher order derivatives in terms of the generating function and its derivatives each other, deduce an explicit formula and an identities for the Chebyshev polynomials of the second kind, derive the inverse of an integer, unit, and lower triangular matrix, present several identities of the Catalan numbers, and give some remarks on the closely related results including connections of the Catalan numbers respectively with the Chebyshev polynomials, the central Delannoy numbers, and the Fibonacci polynomials.

Based on collected power generation data associated with solar irradiance, PV system conversion efficiency and cell temperature, an hourly solar PV power estimation model by a parallel artificial neural network (ANN) and particle swarm optimization (PSO) algorithm is proposed. Weight matrices related to different seasons and geographic areas for estimation power generations have been trained by real measured operation data. The parallel PSO algorithm with heuristic global optimization technique assists the ANN training process to get near optimal solutions precisely. The accuracy and reliability of estimation is audited by actual details of photovoltaic power stations in various regions and scales. The results of estimation model can not only assist the electricity dispatcher to explicitly monitor the trend of solar power generation in different areas, but also coordinate with traditional power plants to meet load demand more accurately. The presented model will bring benefits to power dispatching for larger scales of intermittent and unstable solar power generation.

Anthocyanins extract from purple tomato (PTA) was incorporated with polyvinyl alcohol (PVA) so that a series of colorimetric films of PVA/PTA (based on PVA) were prepared. The role of anthocyanin on color response, FTIR, thickness, water content, mechanical properties, antioxidant activity, and permeation of water vapor through the films was examined. In addition, its application in smart packaging to assess the freshness of shrimp was studied. It was found that the tensile strength, contact angle and WVP of PVA/PTA films increases with the addition of more PTA, while the elongation at break and water content decreased. FTIR analysis showed that there are interactions between PTA and PVA matrix. The addition of anthocyanins caused to a significant improvement for the antioxidant properties of PVA films. Furthermore, the total volatile alkaline nitrogen (TVB-N), total plate count (TPC) and pH value of shrimp were monitored after 4 days of refrigeration, and the color change of the indexes was recorded. The PVA/PTA films changed color from purple to yellow-green during the storage time of 0-4d for shrimp, this suggests that the film could be used in smart packaging as a real-time freshness indicator for shrimp.

P-band radar remote sensing applied during the Airborne Microwave Observatory of Subcanopy and Subsurface (AirMOSS) mission has shown great potential for estimation of root zone soil moisture. When retrieving the soil moisture profile (SMP) from P-band radar, a mathematical function describing the vertical moisture distribution is required. Because only a limited number of observations are available, the number of free parameters of the mathematical model must not exceed the number of observed data. For example, a second order polynomial that contains 3 free parameters was presumed based on in-situ SMP data. The polynomial is currently parameterized based on 3 backscatter observations provided by AirMOSS (i.e. one frequency at three polarizations of HH, VV and HV). In this paper, a more realistic, physically-based SMP model containing 3 free parameters is derived based on a solution to Richards’ equation for unsaturated flow in soils. Evaluation of the new SMP model based on both numerical simulations and measured data revealed that it exhibits greater flexibility for fitting measured and simulated SMPs than the currently applied polynomial. It is also demonstrated that the new SMP model can be reduced to a second order polynomial at the expense of fitting accuracy.

In this work, we try to find a way to describe the physical law of micro-world under the frame of a space-time theory. By introducing the scalar fields $\mathcal{D}\left( x\right)$ and $\zeta\left( x\right) $, we rewrite the action of conventional field theory and the Lagrangian describing the motion of the particle, where a modified space-time relation is obtained. To test the correctness of this attempt, we demonstrate the Klein-Gordon equation by the Hamilton-Jacobi method in four dimensional form and present a time delay for the ground state of hydrogen atom.

YOLOv8, as an efficient object detection method, can swiftly and precisely identify objects within images. However, traditional algorithms encounter difficulties when detecting small targets in remote sensing images, such as missing information, background noise, and interactions among multiple objects in complex scenes, which may affect performance. To tackle these challenges, we propose an enhanced algorithm optimized for detecting small objects in remote sensing images, named HP-YOLOv8. Firstly, we design the C2f-D-Mixer (C2f-DM) module as a replacement for the original C2f module. This module integrates both local and global information, significantly improving the ability to detect features of small objects. Secondly, we introduce a feature fusion technique based on attention mechanisms, named Bi-Level Routing Attention in Gated Feature Pyramid Network (BGFPN). This technique utilizes an efficient feature aggregation network and reparameterization technology to optimize information interaction between different scale feature maps, and through the Bi-level Routing Attention (BRA) mechanism, it effectively captures critical feature information of small target objects. Finally, we propose the Smooth Mean Perpendicular Distance Intersection over Union (SMPDIoU) loss function. The method comprehensively considers the shape and size of detection boxes, enhances the model's focus on the attributes of detection boxes and provides a more accurate bounding box regression loss calculation method. To demonstrate our approach's efficacy, we conduct comprehensive experiments across the RSOD, NWPU VHR-10, and VisDrone2019 datasets. The experimental results show that the HP-YOLOv8 achieves 95.11%, 93.05%, and 53.49% in the [email protected] metric, and 72.03%, 65.37%, and 38.91% in the more stringent [email protected]:0.95 metric, respectively.

Objective: This study investigated the effect of the hierarchical medical system under the national health insurance program on resident’s healthcare-seeking behavior in Taiwan. Background: Healthcare authorities in Taiwan initiated the allowance reduction of outpatient visits at regional hospitals and higher hierarchical hospitals from 2018. The ultimate goal is to implement a hierarchical medical system and provide the residents accessible as well as consistent medical services. Methods: This research was conducted through the questionnaire survey method and data were collected between August and December 2018 from the records of subjects who had recently sought medical attention. A total of 1,340 valid questionnaires were returned. Results: Regarding the effect on healthcare-seeking behavior, the following factors were significant: being aged between 40 to 49 (p＜.1), subjects with an educational background of junior high school (p＜.05), those who were not aware of the policy (p＜.001), and an awareness about both the hierarchical medical system and the policy to reduce outpatient visits to large hospitals (p＜.001). Conclusion: The public should be made aware about the hierarchical medical system to improve healthcare.

The United Nations' sustainable development goals have underscored the importance of enhancing supply chain sustainability while appropriately distributing orders. This study proposes a novel framework involving Z-number, game theory, indifference threshold-based attribute ratio analysis (ITARA), and combined compromise solution method (CoCoSo) to evaluate the sustainability of suppliers and order allocations. To better reflect the decision makers’ current choices for the sustainability of assessed suppliers and order allocations; enhance the comprehensiveness of decision-making, the importance parameter of the supplier is obtained through game theory objectively for transforming supplier performance into order allocation performance. The Z-numbers are involved in ITARA (so-called ZITARA) and CoCoSo (so-called ZCoCoSo) to overcome the issue of information uncertainty in the process of expert evaluation. ZITARA and ZCoCoSo are applied to assess the objective weight of criteria and the ranking of assessed order allocations, respectively. Afterwards, a case study of China’s company is illustrated the utility of the proposed framework and inform their decision-making process regarding the orders to be assigned to the assessed suppliers.

The challenging terrain and deep ravines characteristic of mountainous regions often result in slower path planning and suboptimal flight paths for Unmanned Aerial Vehicles (UAVs) when traditional meta-heuristic optimization algorithms are employed. This study investigates the application of an Improved Enhanced Snake Optimizer (IESO) for three-dimensional path planning in a simulated rugged mountainous terrain. The initialization process in the enhanced snake optimizer is refined by integrating the Chebyshev chaotic map. Additionally, a non-monotonic factor is introduced to modulate the "temperature," and a boundary condition is incorporated into the dynamic opposition learning mechanism. These modifications collectively reduce the likelihood of population convergence to local optima during optimization. The feasibility of IESO is validated through time complexity and global convergence analyses. Comparative simulation experiments benchmarked IESO against five state-of-the-art optimization algorithms across test functions and path-planning simulated scenarios. The experimental results indicate that the enhanced algorithm achieves superior optimization precision, faster convergence speeds, and improved quality in the planned trajectories by 30%.

Wind energy is a kind of renewable energy with great potential for development. This study mainly investigated the application of shock waves generated by high-pressure gases (wind energy) for generating energy. In this study, we designed a new supersonic shock wave generator that can be reused without disassembling and assembling bolts and developed a supersonic shock wave monitoring system. This system monitored the velocity of the generated shock waves, which was Mach 3-5, and the output pressure was more than 100 times higher than the input pressure of the shock wave generator tank.Then, we developed a power generation system driven by supersonic shock waves based on the characteristics of the new shock wave generator, which can generate high-pressure and high-speed blast waves and can be reused. The shock wave generator can repeatedly generate high-pressure waves to drive the Tesla turbine and then the magnetic energy generator for power generation. We established a complete control process for power generation driven by shock waves by controlling the valve stem. The system can detect the tank pressure, output pressure, gas flow, rotation speed, voltage, and current during the control process for the performance analysis of power generation.

In modern warfare, the diversified tasks can sometimes be challenging to fulfill with a single projectile, necessitating the incorporation of cooperation constraints in trajectory planning. Limited by the stringent requirements of the launch platform and lower costs, the maneuverability and ability to adjust the flight time range of projectiles are weak. Therefore, the rationality of performance indicators and flight time coordination strategies is especially critical. To fully exploit the control capabilities of projectiles, a battlefield area segmentation method is proposed, differentiated performance indicators and a cooperative trajectory planning model that considers the entire range of projectiles are established. Considering the limitations of existing flight time coordination strategies in applications, targeted improvements have been made in different cooperation scenarios, and a bi-level adaptive cooperation strategy(BACS) with both optimality and flexibility is proposed. To rapidly determine feasible conditions, a simple and universal method for obtaining the capability ranges of cooperation is introduced. The multi-phase optimal control problems are transformed into nonlinear programming problems using the Radau pseudo-spectral method, and simulation results show that the proposed methods are capable of handling trajectory planning tasks in different cooperation scenarios. The improved strategies effectively enhance the planning success rate under relatively harsh conditions and BACS demonstrates good compatibility with the problems studied.

Due to constraints in launch platform and cost, the maneuverability of gliding-guided projectiles is limited, necessitating a rational design of their trajectory schemes. To reduce the sensitivity of trajectory schemes to uncertainties while ensuring compatibility between flight schemes and guidance control systems, and fully exploiting the control capability of the projectile, a closed-loop robust trajectory planning method is proposed. Models of major uncertain factors and states deviation at the control-start point are established. Based on the NIPCE method, the stochastic dynamic model is transformed into a high-dimensional deterministic model with PCE coefficients as state variables, and the uncertainty propagation law is obtained. A PID algorithm is employed to design a tracking guidance law based on position error feedback, and open-loop and closed-loop robust trajectory planning models are established accordingly. The optimal control problem is solved by transforming it into a nonlinear programming problem using the direct shooting method. Simulation results indicate that the NIPCE method can significantly improve the computational efficiency of uncertainty propagation while ensuring accuracy. Open-loop robust planning can effectively mitigate the sensitivity of gliding trajectories to uncertainties but cannot completely eliminate terminal dispersion. Closed-loop robust planning effectively improves control effort consumption on the basis of open-loop planning.

Ensuring optimal performance and reliability in rotor-bearing systems is crucial for industrial applications. Imbalance and shaft bow in these systems can lead to decreased efficiency and increased vibrations. Early detection and mitigation of a rotor’s faults are essential, and model-based fault identification has gained much attention in the manufacturing industry for years. Over the past two decades, however, the development of fault diagnosis rules with data-driven and artificial intelligence (AI) has become a trend, and in the foreseeable future, AI combined with big data will become mainstream. Nevertheless, the critical role of rotating machinery in manufacturing introduces a challenge, as the availability of fault data is often insufficient. This limitation renders the establishment of diagnostic rules using data-driven methods and AI technologies impractical. In light of these challenges, this study proposes a novel hybrid approach, that combines a physical model with machine learning (ML) techniques for the diagnosis of multi-faults (imbalance and shaft-bow demonstrated) in a Jeffcott rotor. To overcome the lack of real-world faulted, labeled datasets, a physics-based Jeffcott rotor model is first derived and then used to generate abundant fault datasets for ML. Subsequently, simulated data are employed for the training of an artificial neural network (ANN), enabling the network to learn from and analyze the vast array of generated data. The results prove that a well-trained feed-forward neural network (FNN) can accurately isolate and diagnose the imbalance and shaft-bow faults using the simulated data and the real data from the Jeffcott rotor experiment. These physics-based and ML approaches prove effective particularly for multi-fault, offering new possibilities for advanced rotor system monitoring and maintenance strategies in industrial applications.

In Taiwan, remote healthcare was initially limited to telemedicine services, and the systematic development of remote care was relatively delayed. It was not until 2007 that the Department of Health of the Executive Yuan first initiated the 'Remote Care Pilot Program,' followed by the 'Remote Care Service Improvement and Quality Enhancement Plan' in the subsequent year. In 2010, Taiwan officially launched the 'Remote Health Care Services Development Plan' and established a dedicated project office, marking the comprehensive start-up of remote care services. This stage saw significant contributions from artificial intelligence aids and ICT remote transmission technologies, greatly promoting the application of smart healthcare in home care. This study aims to explore the strategic gaps in the application of smart healthcare in home remote care. By analyzing gaps in 'legal regulations,' 'economic factors,' 'user behavior habits,' 'policy and culture,' and 'environment and technology,' this study employs a mixed-methods approach. Particularly, it uses the Analytic Hierarchy Process (AHP) to construct a weighted ranking of these strategic gaps. Through in-depth interviews with doctors and smart healthcare experts and the collection of 16 valid AHP questionnaire samples, which cover both industry and academia with a balanced distribution, the survey results are ensured to be representative and reliable. The findings indicate that 'legal regulations' are considered the most critical strategic gap that needs to be addressed first, followed by 'user behavior habits.' This suggests that when designing smart healthcare applications, greater consideration needs to be given to user acceptance and habits. By systematically analyzing and addressing these strategic gaps, this study not only provides solutions to issues in the application of smart healthcare in home remote care but also offers valuable references for future research and practice, aiming to make home remote care services more comprehensive and efficient.

We estimated the daily intakes of chlorpyrifos and cypermethrin via ingestion of indoor dust and outdoor soils using the Stochastic Human Exposure and Dose Simulation Model on a probabilistic approach for Taiwan’s homes. Variable information for the daily intake estimation, such as concentration, ingestion rate, body weight, was adopted from previous studies. Monte Carlo simulation was performed with 1,000,000 iterations to simulate a single daily intake, which was shown in terms of percentage of the Acceptable Daily Intake (ADI) of either insecticide. The daily intakes were minimal with a 99% probability; at 99.9th percentile, however, the total intakes leaped to 13.1% and 20.0% of the respective ADIs of chlorpyrifos and cypermethrin. The sensitivity analysis indicated that concentration was the most determinant variable. Compared to the data of daily intakes via dietary ingestion of vegetables derived from a previous study, the estimated intakes by this study were considerable at the highest percentile, which referred to insecticide residues few days after insecticide application. Consequently, the non-dietary ingestion exposure to either insecticide was negligible in most cases; nevertheless, for those with indoor insecticide applications, the daily intakes for young children could be of concern. Frequently home cleaning is recommended to reduce the exposure.

Using machine learning or deep learning to solve the problem of garbage recognition and classification is an important application in computer vision, but due to the incomplete establishment of garbage datasets and the poor performance of complex network models on smart terminal devices, the existing garbage classification models The effect is not good.This paper presents a waste classification and identification method base on transfer learning and lightweight neural network. By migrating the lightweight neural network MobileNetV2 and rebuild it, The reconstructed network is used for feature extraction, and the extracted features are introduced into the SVM to realize the identification of 6 types of garbage. The model was trained and verified by using 2527 pieces of garbage labeled data in the TrashNet dataset, which ultimately resulted in a classification accuracy of 98.4% of the method, which proves that the method can effectively improve the classification accuracy and time and overcome the problem of weak data and less labeling. The over-fitting phenomenon encountered by small data sets in deep learning makes the model robust.

The innate immune system is the first line of host defense sensing viral infection. Manganese (Mn) has recently been found to be involved in the activation of innate immune DNA sensing cGAS-STING pathway and subsequent anti-DNA virus function. However, whether Mn2+ mediates host defense against RNA viruses is still unclear. In the current study, we demonstrated that Mn2+ exhibited antiviral effects against various animal and human viruses including RNA viruses such as PRRSVs and the VSV as well as a DNA virus such as the HSV1 in a dose-dependent manner. Moreover, cGAS and STING were both investigated in the Mn2+ mediated antiviral roles using the knockout cells made by CRISPR-Cas9 approach. Unexpectedly, the results revealed that neither cGAS knockout nor STING knockout had any effect on Mn2+ mediated antiviral functions. Nevertheless, we verified that Mn2+ promoted the activation of cGAS-STING signaling pathway. These findings suggest that Mn2+ has broad spectrum antiviral activities in a cGAS-STING pathway independent manner. This study also provides significant insights into redundant mechanisms participating in the Mn2+ antiviral functions and also indicates new target for Mn2+ antiviral therapeutics.

This paper uses the complex regression analysis method to establish the customer’s load regression models, which consider economic indicators, temperature and rainfall. Furthermore, the proposed models are used to study the forecasting feasibility of the future energy sales and summer peak load demand. At first, this paper used least-squares techniques to derive regression models for considering economic indicators and temperature of 34 customer energy sales and total energy sales. Besides, the AMI high voltage customer demand data and system generating capacity for 24 hours were adopted to forecast summer peak load. The above-mentioned data analysis tool is used by EViews software to achieve, in order to verify the feasibility of the research framework. The study found that although its forecasting model accuracy is low only when mixed with temperature and high voltage demands. So, when mixed with high voltage demand data and system generating capacity for 24 hours to forecast peak load, the average error is ± 0.87% and in the majority of its energy sales forecasting model of average error is ±3%. This result can provide power company as future reference.

Saliency detection in synthetic aperture radar (SAR) image is a difficult problem. This paper proposed a multitask saliency detection (MSD) model for the saliency detection task of SAR image. Firstly, we extract four features of SAR image as the input of the MSD model, which include the intensity, orientation, uniqueness and global contrast. Then, the saliency map is generated by the multitask sparsity pursuit (MTSP) which integrates the multiple features collaboratively. Subjective and objective evaluation of the MSD model verifies its effectiveness. Based on the saliency maps of the source images, an image fusion method is proposed for the SAR and color optical image fusion. The experimental results of real data show the proposed image fusion method is superior to the presenting methods in terms of several universal quality evaluation indexes, as well as in the visual quality. The salient areas in the SAR image can be highlighted and the spatial and spectral details of color optical image can also be preserved in the fusion result.

Teachability has been extensively studied under the context of making industrial robots to be programmable and reprogrammable. However, it is only recently that the artificial intelligence (AI) research community is accelerating the research works with the objective of making humanoid robots and many other robots to be teachable under the context of using natural languages. We human beings spend many years to learn knowledge and skills despite our extraordinary mental capabilities of being teachable with the use of natural languages. Therefore, if we would like to develop human-like robots such as humanoid robots, it is inevitable for us to face the issue of making future humanoid robots to be teachable with the use of natural languages as well. In this paper, we present the key details of a top-down design for achieving a teachable mind which consists of two major processes: the first one is the process which enables humanoid robots to gain innate mental capabilities of transforming incoming signals into meaningful crisp data, and the second one is the process which enables humanoid robots to gain innate mental capabilities of undertaking incremental and deep learning with the main focus of associating conceptual labels in a natural language to meaningful crisp data. These two processes consist of the two necessary and sufficient conditions for future humanoid robots to be teachable with the use of natural languages. In addition, this paper outlines a very likely new finding underlying human brain’s neural systems as well as the obvious mathematics underlying artificial deep neural networks. These outlines provide us the strong reason to separate the study of mind from the study of brain. Hopefully, the content discussed in this paper will help the AI research community to venture into the right direction which is to make future humanoid robots, non-humanoid robots, and many other systems to achieve human-like self-intelligence at cognitive level with the use of natural languages.

The limited understanding of how digital platforms, especially the Metaverse, influence public perception and attitude towards sustainable fashion in large scaled markets such as China highlights a critical gap. This study aims to examine the perspectives and perception of the Chinese public regarding sustainable fashion in the Metaverse. Through content analysis, this study evaluated 3,889 Weibo posts from Shanghai Fashion Week 2024 to identify key sentiments and discussions on sustainable and digital fashion. Results indicate that 76.08% of the conversations centered on sustainable fashion, reflecting strong public commitment to environmental issues. The findings highlight characteristics of public perception towards the utilization of immersive technologies and underscore the Metaverse's potential as a platform for fostering environmental consciousness in the fashion industry. This research provides crucial insights for fashion brands looking to integrate sustainability into their digital strategies, addressing a significant gap in current literature and offering practical guidance for leveraging digital platforms to promote sustainable consumption.

Pure titanium is limited to be used in biomedical applications due to its lower mechanical strength compared to its alloy counterpart. To enhance its properties and improve medical implants feasibility, advancements in titanium processing technologies are necessary. One such technique is equal channel angular pressing (ECAP) for its severe plastic deformation (SPD). This study aimed to surface modify commercially pure titanium using micro arc oxidation (MAO) technology and mineral solutions containing Ca and P. The composition and shape of the changed surface were characterized using X-ray diffraction (XRD) and scanning electron microscope (SEM), respectively. The weight % of Ca and P in the coating was determined using Energy Dispersive Spectroscopy (EDS), and the corrosion resistance was evaluated through potentiodynamic measurement. The behavior of human dental pulp cell and periodontal cell behavior was also studied through a biomedical experiment over a period of 1-, 3-, and 7-days using trypsin as the culture medium and ELISA as the observation method. This study showed that the mechanical grain refinement method and surface modification significantly improved the biomechanical properties of commercially pure (CP) Titanium. Although the results showed variations in the absorbance values of cells cultured on different surfaces, this study provides valuable insights into pulp cell behavior and advances the field of biomedical research.

The spin-torsion theory is a gauge theory approach to gravity that expands upon Einstein's general relativity (GR) by incorporating the spin of microparticles. In this study, we further develop the spin-torsion theory to examine spherically symmetric and static gravitational systems that involve free-falling macroscopic particles. We posit that the quantum spin of macroscopic matter becomes noteworthy on cosmic scales. We further assume that the Dirac spinor and Dirac equation adequately capture all essential physical characteristics of the particles and their associated processes. A crucial aspect of our approach involves substituting the constant mass in the Dirac equation with a scale function, allowing us to establish a connection between quantum effects and the scale of gravitational systems. This mechanism ensures that the quantum effect of macroscopic matter is scale-dependent and diminishes locally, a phenomenon not observed in microparticles. For any given matter density distribution, our theory predicts an additional quantum term, the quantum potential energy (QPE), within the mass expression. QPE induces time dilation, distance contraction, and thus mimics a gravitational well. When applied to cosmology, our theory yields a static cosmological model. The QPE serves as a counterpart to the cosmological constant introduced by Einstein to balance gravity in his static cosmological model. The QPE also offers a plausible explanation for the origin of the Hubble redshift (traditionally attributed to the universe's expansion). The predicted luminosity distance-redshift relation aligns remarkably well with SNe Ia data from the cosmological sample of SNe Ia. In the context of galaxies, QPE functions as the equivalent of dark matter. The predicted circular velocities align well with the rotation curve data from the SPARC (Spitzer Photometry and Accurate Rotation Curves database) sample. Importantly, our conclusions in this paper are reached through a conventional approach, with the sole assumption of the quantum effects of macroscopic matter on large scales, without the need for additional modifications or assumptions.

Pneumonia remains a major cause of morbidity and mortality worldwide, especially during COVID-19 pandemic. With the significant global health burden that pneumonia poses, it is es-sential to improve therapeutic and management strategies. The increasing emergence of antibiotic resistant bacterial strains limits options for effective antibiotic use. New antibiotics for treatment of pneumonia may address deficits in current antimicrobial drugs, with an ability to cover both typical, atypical, and resistance pathogen. Several of these newer drugs also have structural characteristics that allow for a decreased propensity in development of bacterial resistance. Po-tential use of stem cell therapies in place of corticosteroid treatments may also offer an im-provement in patient outcomes. Human mesenchymal stem cell treatments have shown efficacy and safety in treating COVID-19 induced pneumonia. Combined treatment with both stem cells and antibiotics in pneumonia in a rabbit model has also shown significantly increased efficacy in comparison to antibiotic treatment alone, presenting yet another possible route for a novel strategy in treating pneumonia, though additional future studies are necessary before clinical implementation. While pneumonia remains a major disease of concern, having newer approved antibiotics as well as novel therapies such as stem cell treatments in the pipeline offers clinicians more options in effectively treating pneumonia.

The heavy metal lead (Pb) can irreversibly damage the human nervous system. To help understand Pb-induced damage, we applied a genetically encoded Förster resonance energy transfer (FRET)-based Pb biosensor Met-lead 1.44 M1 to two living systems to monitor the concentration of Pb: induced pluripotent stem cell (iPSC)-derived cardiomyocytes as a semi-tissue platform, and Drosophila melanogaster fruit flies as an in vivo animal model. Different FRET imaging modalities were used to obtain FRET signals, which represented the presence of Pb in the tested samples in different spatial dimensions. Using iPSC-derived cardiomyocytes, the relationship between beating activity (20–24 beats per minute, bpm) determined from the fluctuation of fluorescent signals and the concentrations of Pb represented by the FRET emission ratio values of Met-lead 1.44 M1 was revealed from simultaneous measurements. Pb (50 μM) affected the beating activity of cardiomyocytes, whereas two drugs that stop the entry of Pb differentially affected this beating activity: verapamil (2 μM) did not reverse the cessation of beating, whereas 2-APB (50 μM) partially restored this activity (16 bpm). The results clearly demonstrate a potential of this biosensor system as an anti-Pb drug screening application. In the Drosophila model, Pb was detected within the adult brain or larval central nervous system (Cha-gal4>UAS-Met-lead 1.44 M1) using fast epifluorescence and high-resolution two-photon 3D FRET ratio image systems. The tissue-specific expression of Pb biosensors provides an excellent opportunity to explore the possible Pb-specific populations within living organisms. We believe that this integrated Pb biosensor system can be applied to the prevention of Pb poisoning and advanced research on Pb neurotoxicology.

This paper considers the Hermitian solutions of a new system of commutative quaternion matrix equations, we establish both necessary and sufficient conditions for the existence of solutions. Furthermore, we derive an explicit general expression when it is solvable. To illustrate our main findings, we present two numerical algorithms and examples in this paper.

Deep learning has achieved remarkable success in diverse computer science applications, however, its use in other traditional engineering fields has emerged only recently. In this project, we solved several mechanics problems governed by differential equations, using physics informed neural networks (PINN). The PINN embeds the differential equations into the loss of the neural network using automatic differentiation. We present our developments in the context of solving two main classes of problems: data-driven solutions and data-driven discoveries, and we compare the results with either analytical solutions or numerical solutions using the finite element method. The remarkable achievements of the PINN model shown in this report suggest the bright prospect of the physics-informed surrogate models that are fully differentiable with respect to all input coordinates and free parameters. More broadly, this study shows that PINN provides an attractive alternative to solve traditional engineering problems.

This study uses a recently developed theory and technique to examine post-acquisition evidence as to the motives for mergers and acquisitions(M&As), and decomposed the M/B ratio into three components: firm-specific error, time-series sector error, and long-run value-to-book. We make a multidimensional grouping according to the frequency of M&As , payment method, proportion of shares acquired, M/B ratio before the merger and total assets of the acquirers before the merge. The results confirm that M&As involve multiple motives, such as market timing, industry and economic shocks, agency and hubris. Using a sample of 2,035 M&As in China, we find that 59% are related to market timing, 68% are related to agency and hubris, 21% are related to industry and economic shocks, 51% are related to multiple motives. Our empirical research finds that the main motives for M&As of listed companies in China are value-decreasing, which have negative impact on the acquirers‘ sustainable development.

Interferon regulatory factor 5 (IRF5) is known to be involved in the innate immune response and pro-inflammatory cytokines. However, the roles of IRF5 in immune responses in Malabar grouper (Epinephelus malabaricus) have not been extensively explored. In this study, IRF5 gene was identified and characterized from M. grouper. The full-length IRF5 cDNA consisted of a 5’ terminal untranslated region (5’-UTR) of 289 bp and a 3’-UTR of 542 bp, an open reading frame (ORF) of 1500 bp encoding a polypeptide of 499 amino acids with a predicted molecular mass of 56.28 kDa and isoelectric point (pI) of 5.2. The putative MgIRF5 protein consists of four important conserved domains: a helix DNA-binding domain (DBD) at the N-terminus, a middle region, an IRF association domain (IAD) and a virus activated domain (VAD) at the C-terminus. Sequence alignment and phylogenetic analysis showed that highest sequence similarity of IRF5 was observed between the IRF5 genes from Oplegnathus fasciatus and Miichthys miiuy. The mRNA transcripts of IRF5 were detected in a wide range of tissues types from healthy M. grouper with highest expression in muscle, liver and skin. After treatment with poly (I: C), it was significantly up-regulated in spleen and liver tissues. When infected with NNV, the expression level of MgIRF5 was up-regulated in spleen and head kidney and their transcriptional responses to IRF5 increased in the grouper kidney cells. This approach suggests that MgIRF5 is important in the underlying mechanism of the innate immune responses against antiviral response.

The chitin synthase B gene is a key enzyme in the chitin synthesis of insect peritrophic matrix (PM), affecting insects' feeding behavior. The chitin synthase B gene has been cloned from the transcription library of Heortia vitessoides Moore. RT-qPCR showed that HvChsb was highly expressed in the larval stage of H. vitessoides, especially on the first day of the prepupal stage, and in the midgut of larvae and the abdomen of adults. After starvation treatment, HvChsb was found to be significantly inhibited with time. After 48 h of starvation, the feeding experiment showed that HvChsb increased with the prolongation of the refeeding time. The experimental data showed that feeding affected the expression of HvChsb. HvChsb was effectively silenced by RNA interference, so its function was lost, significantly decreasing the survival rate of H. vitessoides. The survival rate from larval-to-pupal stages was only 43.33%, accompanied by abnormal phenotypes. It can be seen that HvChsb plays a key role in the average growth and development of H. vitessoides.

A practical method is presented to estimate rare earth elements (REE) concentrations in magmatic vapour phase (MVP) in equilibrium with water-saturated granitic melts based on empirical fluid-melt partition coefficients of REE (k_P^REE). The values of k_P^REEcan be calculated from a set of new polynomial equations linking to the chlorine molality (m_Cl^v) of the MVP associated with granitic melts, which are established via a statistical analysis on the existing experimental dataset. These equations may be applied to the entire pressure range (0.1 to 10.0 kb) within the continental crust, suggesting that light REEs behave differently in magmatic fluids, i.e. either being fluid compatible with higher m_Cl^v or fluid incompatible with lower m_Cl^v values. In contrast, heavy REEs are exclusively fluid incompatible and partition favourably into granitic melts. Consequently, magmatic fluids tend to be rich in LREE relative to HREE, leading to REE fractionation during the evolution of magmatic hydrothermal systems. Maximum k_P^REEvalue for each element is predicted and presented in a REE distribution diagram constrained by the threshold of m_Cl^v. REE contents of the granitic melt is approximated by whole-rock analysis, so that REE concentrations in the associated MVP would be estimated from the value of k_P^REE given chemical equilibrium retains. Two examples are provided respectively, to show the use of this method as a REE tracer to fingerprint the source of ore-fluids responsible for the Lake George intrusion-related Au-Sb deposit in New Brunswick (Canada), and for the Bakircay Cu-Au (-Mo) porphyry systems in northern Turkey.

In the paper, the authors establish two identities, which can be regarded as nonlinear differential equations, for the generating function of Eulerian polynomials, find two identities for the Stirling numbers of the second kind, and present two identities for Eulerian polynomials and higher order Eulerian polynomials, pose two open problems about summability of two finite sums involving the Stirling numbers of the second kind. Some of these conclusions meaningfully and significantly simplify several known results.

Estimates of extreme water level return periods in river systems are crucial for hydraulic engineering design and planning. Recorded historical water level data of Taiwan’s rivers are not long enough for traditional frequency analyses when predicting extreme water levels for different return periods. In this study, the integration of a one-dimensional flash flood routing hydrodynamic model with the Monte Carlo simulation was developed to predict extreme water levels in the Danshuei River system of northern Taiwan. The numerical model was calibrated and verified with observed water levels using four typhoon events. The results indicated a reasonable agreement between the model simulation and observation data. Seven parameters, including the astronomical tide and surge height at the mouth of the Danshuei River and the river discharge at five gauge stations, were adopted to calculate the joint probability and generate stochastic scenarios via the Monte Carlo simulation. The validated hydrodynamic model driven by the stochastic scenarios was then used to simulate extreme water levels for further frequency analysis. The design water level was estimated using different probability distributions in the frequency analysis at five stations. The design high-water levels for a 200-year return period at Guandu Bridge, Taipei Bridge, Hsin-Hai Bridge, Da-Zhi Bridge, and Chung-Cheng Bridge were 2.90 m, 5.13 m, 6.38 m, 6.05 m, and 9.94 m, respectively. The estimated design water levels plus the freeboard are proposed and recommended for further engineering design and planning.

Rollover prevention of partially-filled tank trucks is an industry teaser, with the core challenge being real-time perception and observation of the liquid state inside the tank. In order realize re-liable observation of sloshing liquid, this article firstly proposes a sloshing modeling method based on multi-degree-of-freedom pendulum model, and derives the double mass trammel pendulum model (DMTP, 2DOF) accordingly, which accurately reflects the sloshing dynamics under more pervasive working conditions. Secondly, a free surface fluctuation sensor is designed based on magnetostriction, capable of measuring the inclination and height of the liquid level inside tanks filled with hazardous chemical. Finally, the unscented Kalman filter (UKF) is utilized to synthesize the information of the two, establishing a credible real-time observation of the sloshing liquid. Verified through vehicle-fluid coupled co-simulation, under condition of con-secutive double lane change, observation error of the proposed method is only 25.9% that of the open-loop calculation, providing a secure guarantee for the observation of the state variables of the single pendulum model (SP) used for most kinds of anti-rollover controller.

Objective: To sort out the research hotspots of the application of VR in rehabilitation medicine, analyse its research themes and research trends, and offer a reference for future related research in this field. Methods: This paper provides an in-depth analysis of the development process, research hotspots and research trends in the field of VR application in rehabilitation medicine research, taking the Web of Science core dataset as the source and using bibliometric analysis by CiteSpace. Results: The application of VR in rehabilitation medicine was composed of three stages, and the research topics were reviewed in five aspects: neurological rehabilitation, psychology treatment, pain distraction, cardiopulmonary rehabilitation, and visual spatial disorder. Limitations: The literature data only come from the Web of Science core dataset, and the data sample size was not comprehensive. Conclusion: Overcoming VR technology-induced vertigo and mental disorders from overuse of VR are both challenges to research on the application of VR in rehabilitation medicine. In addition, developing VR products with better experience, developing standardized guidelines, and conducting more high-quality clinical studies are all future research trends for the application of VR in rehabilitation medicine.

This study aimed to investigate the relationship between sleep duration, dementia severity, age, and ANS regulation. This cross-sectional pilot study included 27 older patients with probable Alzheimer’s disease, hospitalized at a psychiatric center. We measured heart rate variability to assess ANS regulation at night, evaluated dementia severity using the Clinical Dementia Rating scale, and obtained sleep duration data from sleep diaries maintained by psychiatric nurses. The data were analyzed using repeated-measures generalized linear models with age, sex, dementia severity, and medication (antipsychotics) as covariates. A sleep duration of 7–8 h per night was associated with better ANS regulation than other sleep durations, as indicated by sympathovagal balance (p = 0.005). ANS dysregulation was characterized by a 20.7% increase in sympathetic nervous system activity and a 14.8% decrease in parasympathetic nervous system (PSNS) activity. We found a significant correlation between dementia severity and PSNS activity (p = 0.04) and observed an inverted U-shaped association between sleep duration and ANS regulation. This pilot study demonstrated that a sleep duration of 7–8 h per night may be critical in maintaining optimal ANS regulation. Bidirectional associations between sleep duration, inadequate sleep duration, aging, and ANS regulation warrant further investigation.

Gestational Diabetes Mellitus (GDM) is related with adverse outcomes for both the mother and the offspring. Immune and senescence play a crucial role in GDM progression. This study aims to explore the diagnostic significance of immune-related senescence (IRS) genes in GDM. We used weighted gene co-expression network analysis (WGCNA) and single sample gene set enrichment analysis (ssGSEA) to compute the immune score and aging score in control and GDM samples. Machine learning identified core IRS genes. Then we performed unsupervised cluster analysis in GDM patients to explore immune infiltration. Finally, we validated the core genes in clinical samples. We used the intersection of MEblack module from WGCNA and differentially expressed genes (DEGs) to obtain the potential genes. Next, a univariate logistic regression model including 23 potential genes were constructed, and these genes were filtered by least absolute shrinkage and selection operator (LASSO) algorithm. There were 5 potential genes (COX17, RRAS2, RRAGC, CECR1, and TACC2), which defined as biomarkers, remained eventually, and the efficacy of these biomarkers was evaluated by nomogram. Finally, the results from both qRT-PCR and western blot analyses demonstrated CECR1 was down-regulated, while TACC2 was up-regulated in GDM placental tissue. Our study identified CECR1 and TACC2 as diagnostic biomarkers for GDM associating with immune and senescence, providing a new perspective on GDM progression.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Saudi Arabia is a prominent producers of dates, with 1.6 million tons annually. There is a need to evaluate physical properties and quality of fruits non-destructively and then be modeled and predicted throughout the storage period. The aim of the current study was to generate a quality index (Qi) and Near-infrared spectra (NIR) models non-destructively to predict properties of Barhi dates fruits including objective and sensory evaluations. The engineering properties of Barhi dates were measured and modeled with quality index (Qi) based on NIR of fresh Barhi fruits (hardness, color, TSS, pH, and sensory evaluations) and during storage in cold, ambient, and controlled at-mosphere (CA) for up to four months. The prediction of Qi is non- destructively based on NIR utilizing PLSR and ANN data analysis. The results showed that the Qi generated corresponds with high precision to the characteristics of the examined fruits through the duration of the storage period with R2 of 0.96. The NIR spectrum proves to be an efficient method to evaluate the Barhi fruits' quality index. where ANN was found to be more suitable than PLSR analysis. Thus, NIR can be utilized to accurately predict the Qi of fruits quality effectively throughout the handling, processing, transporting, storage, and retail sector supply chain.

Manual interpretation of these huge amounts of image volumes are susceptible to inter-reader variability and human error. Thus, accurate automated CAD scheme is highly desirable in clinical pathological diagnosis. In this research, plethora of machine learning paradigms (e.g. feature extraction, dimensionality reduction and supervised classification methods) were explored, evaluated, compared and analyzed to identify the optimal pathway for brain MR images (normal vs neoplastic) binary classification task. External validation dataset was used to test the generalizability of the optimal predictive models implemented. Relevant and informative features were selected to construct cross-validated decision tree and eventually simple rule set was built based on the decision tree. The experimental results show that almost all pattern recognition paradigms achieve high accuracy with careful selection of number of attributes. LDA+ELM with 55 features are the optimal pipelines which achieve perfect classification when training and test data are of same source; and achieving (accuracy=97.5%, AUC=0.989, sensitivity=95% and specificity=100%) under balanced test dataset; (accuracy=99.5%, AUC=0.988, sensitivity=95% and specificity=100%). Cross-validated decision tree model also shows comparable performance: accuracy=98.8%, AUC=99.1%, sensitivity=99.6% and specificity=98.2%. Three highly relevant and robust attributes are visualized and selected for construction of decision tree models and finally a rule sets are read directly off the decision tree. This rule sets can potentially serve as fast and accurate classification algorithm.

This paper aims the automatic ball balancers (ABBs) used in passive balancing devices for suppressing vibration of the eccentric rotor. The system model describes which equipped with a skew-mounted ABB with angular deviation. The dynamic equilibrium equations of the system are deduced from the perspective of three-dimensional (3D) dynamics. The results obtained are consistent with those derived from the Euler-Lagrange equations. It is exciting that the spatial dynamics method reveals the spatial geometric characteristic of dynamic balance positioning of the balls when the system is balanced with vibration suppression. The spatial property emerges the perpendicular line from each ball to the rotating spindle of the system must pass through the central axis of the orbit perpendicular to the ABB plane. This characteristic is a general rule that can be used to explain the phenomenon of the stable equilibrium positions of the balls in all previously studied cases.

Shrews (Soricidae) are common small wild mammals with a significant overlap in their habitats with humans and domestic animals. Currently, viruses from 24 families have been identified in shrews, including Adenoviridae, Arenaviridae, Arteriviridae, Astroviridae, Bornaviridae, Caliciviridae, Circoviridae, Coronaviridae, Filoviridae, Flaviviridae, Hantaviridae, Hepadnaviridae, Hepeviridae, Nairoviridae, Orthoherpesviridae, Paramyxoviridae, Parvoviridae, Phenuiviridae, Picornaviridae, Polyomaviridae, Poxviridae, Rhabdoviridae, Sedoreoviridae, and Spinareoviridae, which pose potential threats to humans and domestic animals. This review compiled fundamental information about shrews and provided a comprehensive summary of the viruses that have been detected in shrews, with the aim to facilitating a deeper understanding of shrews and the diversity and risks of their viruses for researchers and the general public.

In all areas of medicine, especially in radiology, computers are increasing year by year. Filmless radiology, speech recognition software, electronic application forms, and teleradiology are recent developments that have greatly improved radiologists' performance. This research explores radiology software trends, predictions, and the challenges posed by informatics and historical trend analysis. The rationale behind this research is that information technology (IT) is overgrowing almost every day. We must continuously seek new ways to apply IT to make more use of resources. Consequently, IT becomes increasingly crucial to radiology organizations' innovative thinking, workflow, and business models. This study aimed to analyze all radiology software publications in the Science Citation Index (SCI). From 1991 to July 2021, SCI was used to search for publications systematically. We have also widely used this historical method in radiology software research. The findings and discussions are base on an assessment of trends, predictions, contributions, and challenges in radiology software, and we are exploring radiology software with six evolutionary stages. The gift of this research is that radiology managers realize that the use of new information technologies is closely related to survival in a competitive environment. Radiology companies can review these new technologies to develop more innovative business models and services to improve operational deficiencies.

This paper revisits the analytical theory of fractional vibrations with the highlights in five aspects. First, we address the cases of structures with frequency dependent mass or damping or stiffness in Sections 2-4. Second, we introduce the theory based on the general second-order vibration motion equation with frequency dependent elements (mass, damping, stiffness) in Sections 5-7. Third, we present the analytical theory of seven specific classes of second-order vibration systems with frequency dependent mass or damping or stiffness in Sections 8 and 9. Fourth, we bring forward the analytical theory of seven classes of fractional vibration systems in Sections 10-12. Finally, as an application, we give the closed form expression of the forced response to multi-fractional Euler-Bernoulli beam in Section 13. The explanation of the nonlinearity of fractional vibrations is given in Section 14.

In recent years, the taxonomy of the families of Phenuiviridae, Nairoviridae, and Peribunyavidae in Bunyavirales was updated frequently, because many novel viruses in these families have been identified and the species demarcation criteria of these families have been changed. As per these criteria and sequence analysis, we found that the taxonomy of 19 species in these families should be revised. We presented six proposals for optimizing virus species taxonomy using the examples from these families. First, the species demarcation criteria for the same family (e.g., Peribunyavidae) should be unified. Second, the methods and parameters for the taxonomic calculation in the same order (e.g., Bunyavirales) should be unified. Third, virus species taxonomy should be based on phylogenetic relationships, rather than a cutoff value of sequence identities that is a self-contradictory demarcation criterion, although sequence identities aid virus taxonomy greatly. Fourth, virus species taxonomy should be based on the phylogenetic relationship of a key viral gene (e.g., the RdRp gene of Bunyavirales), which is important for the taxonomy of virus recombinants or reassortants. Fifth, a virus can be demarcated without a species before its biomedical significance has been revealed. Sixth, names of all viruses and virus species should be constituted exclusively with common characters (English letters and Arab numbers), to minimize difficulty in spelling and communication. These proposals are rational, flexible, and can accommodate all known viruses. They can also bridge the taxonomy history and the future demands due to their flexibility.