Objective: To use the ancient and modern medical record cloud platform (V2.3.5) to organize and explore the medication patterns of the "Three Causes, Extremity, and One Disease Syndrome Formula" by Chen Wuxuan, and to summarize its therapeutic ideas. Method: Collect and organize the "San Yin Si Tian Fang" in the "San Yin Ji Yi Zheng Fang Lun", and use the modern medical record cloud platform (V2.3.5) to conduct medication frequency statistical analysis, cluster analysis, and complex network analysis. As a result, a total of 16 Chinese herbal medicines were collected in the "Three Causes, Extreme and One Disease Syndrome Formula", involving 75 traditional Chinese medicines. Statistical analysis showed that roasted licorice was the most commonly used, followed by Pinellia ternata, papaya, ginger, and Poria cocos; Medications mainly include warm drugs, sweet and pungent flavors, as well as drugs that promote lung and spleen meridians. Cluster analysis can divide the above-mentioned traditional Chinese medicine into two groups, with specific grouping as follows. Group 1: ginger, white peony, aconite, papaya, and achyranthes bidentata; Group 2: roasted licorice, poria cocos, dried ginger, pinellia ternata, and green peel. Conclusion: The characteristics of the 16 prescriptions are biased towards Xin Gan Wen, emphasizing the regulation of the spleen and stomach, which may be related to the common use of prescription by doctors in the Song Dynasty and the tendency towards warm and dry medication.

Endotoxins are toxic substances that widely exist in the environment and can enter the intestine with food and other substances. Intestinal epithelial cells are protected by a mucus layer that contains MUC2 as its main structural component. However, a detailed understanding of the mechanisms involved in the function of the mucus barrier in endotoxin penetration is lacking. Here, we established the most suitable proportion of Caco-2/HT-29 co-culture cells as a powerful tool to evaluate the intestinal mucus layer. Our findings significantly advance current knowledge as focal adhesion and ECM-receptor interaction were identified as the two most significantly implicated pathways in MUC2 small interfering RNA (siRNA)-transfected Caco-2/HT-29 co-culture cells after 24 h of LPS stimulation. When the mucus layer was not intact, LPS was found to damage the tight junctions of Caco-2/HT29 co-cultured cells. Furthermore, LPS was demonstrated to inhibit the integrin-mediated focal adhesion structure and damage the matrix network structure of the extracellular and actin microfilament skeletons. Ultimately, LPS inhibited the interactive communication between the extracellular matrix and the cytoskeleton for 24 h in the siMUC2 group compared with the LPS(+) and LPS(-) groups. Overall, we recognized the potential of MUC2 as a tool for barrier function in several intestinal bacterial diseases.

Although Eulerian approaches are standard in computational acoustics, they are less effective for certain classes of problems like bubble acoustics and combustion noise. A different approach for solving acoustic problems is to compute with individual particles following particle motion. In this paper, a Lagrangian approach to model sound propagation in moving fluid is presented and implemented numerically, using three meshfree methods to solve the Lagrangian acoustic perturbation equations (LAPE) in the time domain. The LAPE split the fluid dynamic equations into a set of hydrodynamic equations for the motion of fluid particles and perturbation equations for the acoustic quantities corresponding to each fluid particle. Then, three meshfree methods, the smoothed particle hydrodynamics (SPH) method, the corrective smoothed particle (CSP) method, and the generalized finite difference (GFD) method, are introduced to solve the LAPE and the linearized LAPE (LLAPE). The SPH and CSP methods are widely used meshfree methods, while the GFD method based on the Taylor series expansion can be easily extended to higher orders. Applications to modeling sound propagation in steady or unsteady fluids in motion are outlined, treating a number of different cases in one and two space dimensions. A comparison of the LAPE and the LLAPE using the three meshfree methods is also presented. The Lagrangian approach shows good agreement with exact solutions. The comparison indicates that the CSP and GFD method exhibit convergence in cases with different background flow. The GFD method is more accurate, while the CSP method can handle higher Courant numbers.

Hierarchical micro-/mesoporous graphitic carbon spheres (HGCS) with a uniform diameter of ~0.35 μm were synthesized by Fe-catalyzed graphitization of amorphous carbon spheres resultant from hydrothermal carbonization. The HGCS resultant from 3 h at 900 °C with 1.0 wt% Fe catalyst had high graphitization degree and surface area as high as 564 m²/g. They also exhibited high specific capacitance of 140 F/g at 0.2 A/g, good electrochemical stability with 94% capacitance retention after consecutive 2500 cycles. The graphitization degree of the HGCS contributed about 60% of their specific capacitance, and their specific capacitance per unit surface area was as high as 0.2 F/m² which was much higher than in the most cases of porous amorphous carbon materials reported before. In addition, the HGCS showed a high adsorption capacity of 182.8 mg/g for methylene blue (MB), which was 12 times as high as that in the case of carbon spheres before graphitization.

We consider a coded compressed sensing protocol for unsourced massive random access (URA) that concatenates a shared Patterned Reed-Muller (PRM) inner codebook to an outer error-correction code. In this paper, an iterative list PRM projection algorithm is proposed to supplant the signal detector associated with the inner PRM sequences. In particular, we first propose an enhanced paths-saving algorithm called list PRM projection detection for the single-user scenario that keeps multiple candidates for the first few layers to remedy the risk of spreading errors. On this basis, we further propose an iterative list PRM projection algorithm for the multi-user scenario. The vectors for PRM codes and channel coefficients are jointly detected in an iterative manner, which offers significant improvements regarding the convergence rate for signal recovery. Furthermore, the performances of the proposed algorithms are analyzed mathematically, and we verified that the theoretical simulations are consistent with the numerical simulations. Finally, we concatenate the inner PRM codes that employ the iterative list detection to two practical error-correction outer codes. According to the simulation results, we conclude that the packetized URA with the proposed iterative list projection detection works better than benchmarks in terms of the number of active users it can support in each slot and the amount of energy needed per bit to meet an expected error probability.

As an effective active remote sensing (ARS) technology for shallow underground targets, ground penetrating radar (GPR) is a detection method to obtain the characteristic information of underground targets by transmitting electromagnetic wave from the antenna and analyzing the propagation law of the electromagnetic wave underground. Due to the high frequency(1MHz-3GHz) of GPR, the depth of geological exploration is shallow(0.1m-30m). In order to remote sensing the deep earth, it is necessary to increase the size of the radiation source in order to reduce the radiation frequency. At the same time, for most separated GPRs, a single dipole antenna (SD) is used as the radiation source and another antenna device placed along the electromagnetic wave propagation direction in the far field as a remote sensing sensor (RSS), both of which are horizontally linearly polarized (LP) antennas. In some cases, such a design is apt to cause problems such as multipath effect (ME) and polarization mismatch (PM). When GPR in ARS of deep earth is performed, it often results in increased errors, signal attenuation during data reception and processing. In contrast, at the radiation source, with the use of large aperture multiple-dipole antennas (MD) and multi-channel sequential rotational excitation, the electromagnetic wave can radiate outward in the form of circular polarization at a low frequency. At the RSS, the trouble caused by ME and PM can be reduced even if the LP antennas are used. A novel sequential rotationally excited (SRE) circularly polarized (CP) MD array for separated GPR in ARS of deep earth is proposed in this paper, which uses a large aperture CP MD array instead of a small size LP SD. The analysis and simulation results demonstrate that under the premise of the same transmitting power, comparing circular polarization and linear polarization, by using SRE CP MD antennas array radiation source, a significant enhancement (about 7dB) of the Signal to Noise Ratio (SNR) will occur by collecting the radiant energy at the RSS. More importantly, by reducing the exploration frequency to 10KHz, the exploration depth will also be greatly increased by about 10 times.

The adsorption of supramolecular composites for Cs(I) in high level liquid waste (HLLW) are different due to different carriers. We chose 25,27-bis(ethyl)-calix[4]arene-26,28-crown-6 (EC[4]C6) as adsorbent, SiO2-P, XAD-7 and UiO-66 as carriers. The synthesis and characterization of supramolecular EC[4]C6 loaded with three different carriers were presented. SEM, N2 adsorption/desorption isotherms, TG-DSC spectra, FT-IR spectra results shown that EC[4]C6 was successfully introduced into the pores of carriers via physical intermolecular interactions. EC[4]C6/SiO2-P, EC[4]C6/XAD-7 and EC[4]C6/UiO-66 shown high efficiency, high selectivity towards Cs(I) over 18 typical fission or corrosion products in HNO3 solution. The adsorption properties of the three materials were investigated after electron irradiation. These results demonstrate that EC[4]C6/SiO2-P possess greater potential for highly efficient removal of Cs(I) from HLLW.

Passive marine listening, involving the acoustic monitoring of underwater environments, has become increasingly vital for scientific research, environmental monitoring, and defense applications. However, the success of such applications critically depends on the ability to extract meaningful information from the often noisy and dynamic underwater acoustic environment. In this context, Mel-frequency cepstral coefficients (MFCCs) have emerged as an essential tool for feature extraction, capturing the spectral characteristics of marine sounds and making them ideal for species identification and sound event detection. This research presents an innovative approach to enhance the robustness of MFCC-based passive marine listening through adaptive noise reduction techniques. The proposed approach utilizes dynamic spectral subtraction to counter underwater noise, resulting in enhanced signal-to-noise ratios for desired sounds. This adaptive system adjusts to dynamic underwater noise, allowing it to concentrate on target sounds and suppress interference effectively. The experimentation further validates the effectiveness of the proposed approach, with results reaching 99% on the full dataset of 570 mammals and vessels, demonstrating the effectiveness of SVM and Random Forests in the classification of underwater audio.

The purpose of this study is to investigate the moderating effect of technology configuration capability on the relationship between strategic flexibility and organizational performance through different stages of technological life cycle. Through the empirical research on the 439 Chinese high-tech organizations, it shows that a technological configuration capability has enhanced the effect of strategic flexibility to the organizational performance in the complex dynamic environment. However, the impact on the different stages of technological life cycle is different. In addition, this paper explored strategic flexibility on different stages of technological life cycle on the basis of empirical study.

In this study, based on frost formation data provided by Harbin Meteorological Bureau, combined with geographical factors, temperature and population density, linear fitting, Mann-Kendall mutation test, pettitt method and sliding T test were used to analyze the spatio-temporal variation characteristics of frost date in Harbin Municipality and the effects of geographical factors, temperature and population density on frost regularity. The results showed that (1) The earliest year of FSD appeared was 1966 and 1967, on the 255th, i.e., August 18th, and the latest was 283 days, i.e., October 10th, 2006. The earliest year in which the FED appeared was April 24th of 2015, the 114th day of that year, and the latest was April 21st of 1974, the 141st day of that year. The year with the most frost was 2012, with 161 days, and the year with the shortest was 1966, with 123 days. (2) Throughout the study period, FSD increased by 7.8 days at a rate of -1.27d/10a, FED increased by 10.9 days at a rate of 1.77d/10a, and FFS increased by 18.9 days at a rate of 3.05d/10a. The tendency rate of FSD and FFS at each site in Harbin showed an increasing trend. For FED, the tendency rate of some sites showed an increasing trend. In general, FSD showed a delayed trend, FED showed an advanced trend, and FFS showed a prolonged trend. Using the method of unary linear regression, FSD of each site showed an increasing trend, FFS showed an increasing trend, and FED showed a decreasing trend in general. (3) Throughout the study period, FSD was mutated in 2000, and the arrival time of it in the study area averaged the 265th, i.e., September 22nd, and after that, the arrival time of it changed to the 272nd, i.e., September 29th of that year. FED was mutated in 2006, and the arrival time of it in the study area averaged 128th, i.e., April 8th. After the mutation, the arrival time of FED changed to 121st, i.e., April 1st of that year. FFS was mutated in 2004. Before the mutation, with an average arrival time of 137days in the study area .But after that, the time changed to 150 days.(4) FSD and FFS in Harbin Municipality were negatively correlated with latitude and positively correlated with temperature, while FED was positively correlated with latitude and negatively correlated with temperature. The FSD, FED and FFS in the central part of Harbin Municipality were the earliest, the latest and the longest, respectively, so the Pearson correlation coefficient method and the influence of longitude could not be reflected in the multiple regression. Several factors were judged by grey correlation analysis method. The longitude is significantly related to FSD, FED and FFS.

Glioblastoma (GBM) is the most common malignant brain tumor in adults. Despite advancements in treatment, the prognosis for patients with GBM remains poor due to its aggressive nature and resistance to therapy. CRISPR-based genetic screening has emerged as a powerful tool for identifying genes crucial for tumor progression and treatment resistance, offering promising targets for tumor therapy. In this review, we provide an overview of the recent advancements in CRISPR-based genetic screening approaches and their applications in GBM. We highlight how these approaches have been used to uncover genetic determinants of GBM progression and susceptibility to various therapies. Furthermore, we discuss ongoing challenges and future directions of CRISPR-based screening methods in advancing GBM research.

In order to understand the response mechanism between plant stress, physiological indicators and hyperspectral indices, pot experiments were conducted on Suaeda salsa seedlings collected from a coastal wetland area to reveal the effects of salt stress on the physiological indicators and reflectance spectra of Suaeda salsa at the canopy and leaf level. The Suaeda salsa seedlings were exposed to seven salt treatments of different concentrations (0 mmol/L (control), 50 mmol/L, 100 mmol/L, 200 mmol/L, 300 mmol/L, 400 mmol/L, and 600 mmol/L) in natural conditions. The physiological indicators of plant height, fresh weight, dry weight, leaf succulence, chlorophyll content, and carotenoid content were measured, in addition to the reflectance spectra of Suaeda salsa at both the canopy and leaf level. Firstly, the effects of salt stress on the physiological indicators and reflectance spectra were analyzed by the qualitative and quantitative methods. Then, physiological indicators sensitive to salt stress were further retrieved. Afterwards hyperspectral indices such as a/b and ((a-b)/(a+b) ) sensitive to salt stress were also extracted by one-way analysis of variance (ANOVA) and Student-Newman-Keuls (S-N-K) comparison test. Our results showed that plant height, root length, leaf succulence, biomass, Chl-a, and Chl-b were sensitive to salt stress, while carotenoids (Car) and relative water content on the root were not significantly affected by salt stress. At the salt concentration of 200 mmol/L, plant height, biomass, relative water content, leaf succulence peaked. With enhanced salt stress, physiological indicators decreased. The first-order derivative spectral reflectance has the highest correlation with salt stress, compared to the control. The spectral index most sensitive to the salt stress at the canopy level is (D₉₀₃−D₈₅₁)/(D₉₀₃+D₈₅₁), for which the multiple determination coefficient (r²) is 0.9216. While the most sensitive spectral index to the salt stress is (D₄₄₂−D₆₆₇)/(D₄₄₂+D₆₆₇) at the leaf level, for which the r² is −0.898. In summary, the results indicated that there exists the quantitative relationship between the physiological indicators and spectra reflectance under salt stress and hyperspectral plant indices can effectively estimate the degree of salt stress. The inconsistency between the diagnostic hyperspectral plant indices at the canopy and leaf levels may be caused by the observation conditions, canopy structure.

This paper investigates the problem of the optimal arrangement for both UAVs’ caching contents and service locations in UAV-assisted networks based on the context awareness, which considers the influence between users and environment. In the existing work, users within the coverage of UAVs are considered to be served perfectly, which ignores the communication probability caused by line-of-sight (LOS) and non- line-of-sight (NLOS) links. However, the links are related to UAV deployment. Moreover, the transmission overhead should be taken into account. To balance the tradeoff between these two factors, we design the ratio of users’ probability and transmission overhead as the performance measure mechanism to evaluate the performance of UAV-assisted networks. Then, we formulate the objective for maximizing the performance of UAV-assisted networks as a UAV-assisted caching game. It is proved that the game is an exact potential game with the performance of UAV-assisted networks serving as the potential function. Next, we propose the log-linear caching algorithm (LCA) to achieve the Nash equilibrium (NE). Finally, related simulation results reflect the great performance of the proposed algorithm.

The mammalian or mechanistic target of rapamycin (mTOR) integrates multiple intracellular and extra-cellular upstream signals involved in the regulation of anabolic and catabolic processes in cells, and plays a key regulatory role in cell growth and metabolism. Activation of the mTOR signaling pathway has been reported to be associated with a wide range of human diseases. A growing number of in vivo and in vitro studies have demonstrated that the gut microbes and its complex metabolites can regulate host metabolic and immune responses through the mTOR pathway, and result in disorders of host phys-iological functions. In this review, we summarize the regulatory mechanisms of gut microbes and mTOR in different diseases, and discuss the crosstalk between gut microbes and their metabolites and mTOR in the disorders in gastrointestinal tract, liver, heart and other organs. We also discuss the promising appli-cation of multiple potential drugs that can adjust the gut microbiota and mTOR signal pathways. Despite the limited findings between gut microbes and mTOR, elucidating their relationship may provide new clues for the prevention and treatment of various diseases.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

With increasing demand from unmanned driving and robotics, more attention has been paid to point cloud-based 3D object accurate detection technology. However, due to the sparseness and irregularity of the point cloud, the most critical problem is how to utilize the relevant features more efficiently. In this paper, we proposed a point-based object detection enhancement network to improve the detection accuracy in the 3D scenes understanding based on the distance features. Firstly, the distance features are extracted from the raw point sets and fused with the raw features about reflectivity of the point cloud to maximizing the use of information in point cloud. Secondly, we enhanced the distance features and raw features that we collectively refer to them as self-features of the key points in Set Abstraction (SA) layers with the self-attention mechanism, so that the foreground points can be better distinguished from the background points. Finally, we revised the group aggregation module in SA layers to enhance the feature aggregation effect of key points. We conducted experiments on the KITTI dataset and nuScenes dataset and the results show the enhancement method proposed in this paper has excellent performance.

We investigated the response of leaf photosynthetic capacity to climate warming and its variation among provenances of Larix gmelinii (Dahurian larch). Seedlings of 11 L. gmelinii provenances were transplanted into two common gardens with different climate conditions (control and warming climate). We measured the leaf photosynthetic capacity and explored its influencing factors. The warming treatment significantly increased the maximum net photosynthetic rate (Pmax-a), photosynthetic nitrogen use efficiency (PNUE), maximum carboxylation rate (Vcmax), maximum electron transport rate (Jmax), triose phosphate utilization rate (TPU), mesophyll conductance (gm), leaf nitrogen content (Narea), and chlorophyll content (Chlm). The Pmax-a was significantly positively associated with Vcmax, Jmax, TPU, gm, and Narea, and the slope of the correlations between Pmax-a and Vcmax, Jmax, and TPU was steeper in the warming treatment. The responses of Pmax-a, PNUE, Vcmax, Jmax, TPU, Narea, and Chlm to warming differed among provenances. The effects of warming on Pmax-a, Vcmax, Jmax, and TPU increased and then decreased as the aridity index of the original site increased. Overall, the warming treatment improved the photosynthetic capacity of L. gmelinii, but the extent of the improvement varied among provenances. These findings provide insights into the mechanisms underlying the responses of L. gmelinii to climate warming.

High mountain areas are an appropriate indicator of anthropogenic lead (Pb), which can reach the remote mountain ranges through long distance atmospheric transport. We compared the content of Pb in ecologically equivalent rodent species from Tian-Shan with European mountain ranges Tatra, Vitosha and Rila mountains. We used bone tissues from terminal tail vertebrae of small rodents for detection of Pb levels by using electrothermal atomic absorption spectroscopy (AAS). The tail bones of Tian-Shan rodents had significantly lower Pb levels than snow voles from Tatra mountains, but there was no significant difference in comparison with Vitosha and Rila mountains. We can conclude that Tian-Shan shows lower pollution by Pb than Tatra mountains, what may be a reason of longer lasting industrialization of north-western Europe and strongly prevailing west winds in Tatra mountains.

As one of the critical state parameters of the battery management system, lithium battery state of charge (SOC) can provide an essential reference for battery safety management, charge/discharge control, and energy management of electric vehicles. To analyze the application of deep learning in electric vehicle power battery SOC estimation, this study reviewed the technical process, common public datasets, and the neural networks used, structural characteristics, advantages and disadvantages of lithium battery SOC estimation in deep learning method. First, the specific technical processes of the deep learning method for SOC estimation were analyzed, including data collection, data preprocessing, feature engineering, model training, and model evaluation. Secondly, the current commonly and publicly used lithium battery dataset was summarized. Then, the input variables, data sets, errors, and advantages and disadvantages of four types of deep learning methods, were concluded using the structure of neural network used for training as the classification criterion. Finally, the challenges and future development directions of lithium battery SOC estimation in deep learning method were explained.

In this paper, we present a complete, flexible and safe convex-optimization-based method to solve speed planning problems over a fixed path for autonomous driving in both static and dynamic environments. Our contributions are five fold. First, we summarize the most common constraints raised in various autonomous driving scenarios as the requirements for speed planner developments and metrics to measure the capacity of existing speed planners roughly for autonomous driving. Second, we introduce a more general, flexible and complete speed planning mathematical model including all the summarized constraints compared to the state-of-the-art speed planners, which addresses limitations of existing methods and is able to provide smooth, safety-guaranteed, dynamic-feasible, and time-efficient speed profiles. Third, we emphasize comfort while guaranteeing fundamental motion safety without sacrificing the mobility of cars by treating the comfort box constraint as a semi-hard constraint in optimization via slack variables and penalty functions, which distinguishes our method from existing ones. Fourth, we demonstrate that our problem preserves convexity with the added constraints, thus global optimality of solutions is guaranteed. Fifth, we showcase how our formulation can be used in various autonomous driving scenarios by providing several challenging case studies in both static and dynamic environments. A range of numerical experiments and challenging realistic speed planning case studies have depicted that the proposed method outperforms existing speed planners for autonomous driving in terms of constraint type covered, optimality, safety, mobility and flexibility.

Evapotranspiration (ET) is an essential part of energy flow between the surface of the earth and the atmosphere, simultaneously involving the water, carbon, and energy cycles. It is mainly determined by climate change, land use, and land cover changes. Climate change is expected to intensify the hydrological cycle and alter ET. Land use affects ET within regional ecosystems mainly through vegetation changes and agricultural activities such as farmland reclamation, crop cultivation, and agricultural management. However, there is still a need for quantitative characterization of the impacts of climate change and human activities on ET and regional water resource efficiency in arid and semiarid regions. Based on Landsat-8 remote sensing imagery and land use data, the planting structure in the Liangzhou District of the middle reaches of the Shiyang River Basin was identified using a multiband and multitemporal approach in this study. Subsequently, the ET of major cash crops was inverted using the three-temperature model. This research quantitatively describes the responses of wheat and corn to the climate and human activities over a two-year period. Furthermore, the impact of planting structure and climatic factors on ET was elucidated. The results indicate that a combination of multitemporal green and shortwave infrared 1 bands is the optimal spectral combination to extract the planting structure. Compared to 2019, the wheat area decreased by 23.27% in 2020, while the corn area increased by 5.96%. Both crops exhibited significant spatial heterogeneity in ET during the growing season. The typical daily range of ET for wheat was 0.4–7.2 mm/day, and for corn, it was 1.5–4.0 mm/day. Among the climatic factors, temperature showed the highest correlation with ET (R = 0.80, p ≤ 0.05). Our research findings provide valuable insights for the fine identification of planting structures and a better understanding of the response of ET to climatic factors and human activities.

This study employs the reflection symmetry decomposition (RSD) method to extract polarization scattering features from ground object images, aiming to determine the optimal data input scheme for deep learning networks in polarimetric synthetic aperture radar classification. Eight distinct polarizing feature combinations are designed, and the classification accuracy of various approaches is evaluated using the classic convolutional neural networks(CNNs) AlexNet and VGG16. The findings reveal that the commonly employed 6-parameter input scheme, favored by many researchers, lacks the comprehensive utilization of polarization information and warrants attention. Intriguingly, leveraging the complete 9-parameter input scheme based on the polarization coherence matrix results in improved classification accuracy. Furthermore, the input scheme incorporating all 21 parameters from the RSD and polarization coherence matrix notably enhances overall accuracy and the Kappa coefficient compared to the other 7 schemes. This comprehensive approach maximizes the utilization of polarization scattering information from ground objects, emerging as the most effective CNN input data scheme in this study. Additionally, the classification performance using the second and third component total power values (P2 and P3) from the RSD surpasses the approach utilizing surface scattering power value (PS) and secondary scattering power value (PD) from the same decomposition.

Multiaxial fatigue experiments under asynchronous loadings with four different loading frequency ratios were carried out on 30CrMnSiA steel. The experimental results show that the fatigue life decreases when the axial or torsion frequency increases from 1 to 2, while there is no significant change when the axial or torsion frequency increases from 2 to 4. The surface crack paths are observed and show that cracks initiate on the maximum shear stress amplitude planes, propagate approximately tens of microns, and then turn to propagate along the maximum normal stress planes. The number of secondary cracks increases when the axial or torsion frequency increases. Subsequently, the Bannantine-Socie and Wang-Brown cycle counting methods along with various multiaxial fatigue criteria and Palmgren-Miner’s cumulative damage rule were used for fatigue life prediction. The experimental results are consistent with the fatigue life predicted by the Bannantine-Socie method with the section critical plane criterion for 30CrMnSiA steel under asynchronous loading paths.

Water pollution, intensified by the release of hard-to-degrade pollutants, poses severe threats to ecosystems, human health, and economic development. The existing advanced oxidation processes often involve high operational costs and may result in secondary pollution, highlighting the necessity for innovative and more sustainable solutions. To address these challenges, our study introduces a cost-effective and eco-friendly corona discharge barrier plasma discharger for wastewater treatment. Through the central composite design/response surface methodology, a high decolorization rate of 98% of methylene blue (MB) within 10 minutes was achieved by optimizing parameters such as pH and voltage. Furthermore, the mechanisms of the generation of reactive oxygen species via this device was discussed in detail and the degradation pathways of MB were described. Moreover, this device is also very energy-efficient, with a low energy density and electrical energy per order of 0.15 watt/mL and 5.79 kWh/m³/order, respectively. In conclusion, the plasma discharger developed in this study provides a cost-effective and environmentally sustainable solution for dye wastewater treatment. This research contributes significantly to the advancement of sustainable dye wastewater management practices, offering an innovative method that meets both environmental and economic objectives.

Cynomorium songaricum is an important endangered plant with significant medicinal and edible values. However, the lack of resources and quality variation have limited the comprehensive developments and sustainable utilization of C. songaricum. Here, we evaluated chemical and genetic traits of C. songaricum from the highly suitable habitat regions simulated with species distribution models. The PCA and NJ tree analyses displayed intraspecific variation in C. songaricum, that could be divided into two ecotypes: ecotype I and ecotype II. Furthermore, the LC-MS/MS-based metabolomic was used to identify and analyze the metabolites of two ecotypes. The results indicated that a total of 589 compounds were detected, 236 of which were significantly different between the two ecotypes. Specifically, the relative content and the kind of flavonoids were more abundant in ecotype I, which were closely associated with the medicinal activities. In contrast, amino acids and organic acids were more enriched in ecotype II, which may provide better nutritional quality and unique flavor. In summary, our findings demonstrate the ecotype division and chemical diversity of C. songaricum in China from different geographical regions and provide a reference for the development of germplasm and directed plant breeding of endangered medicinal plants.

Neptunea cumingii is an economically important marine shellfish found in the Yellow Sea and Bohai Sea areas of China. However, due to environmental factors, such as global warming, Neptunea cumingii resources are in decline along the coast of China. In this study, samples of Neptunea cumingii were collected in Zhangzidao and Yantai during spring, summer， autumn, and winter to clarify the gene expression patterns and regulatory mechanisms in the gills in different seasons. Transcriptome analysis was conducted using Neptunea cumingii gill tissues and genes with significantly different expression levels were extracted for functional verification. The most genes with differences in expression（DEGs） were found in comparisons of the winter and summer samples. Gene enrichment analysis based on Gene Ontology and Kyoto Encyclopedia of Genes and Genomes terms showed that these DEGs were mainly involved in immune and metabolic pathways, and they had significant effects on oxidative stress, body metabolism, and protein synthesis in Neptunea cumingii. Further screening of DEGs identified 34 genes related to temperature regulation comprising 13 genes with roles in innate immunity in shellfish, 12 genes related to oxidative stress, and nine genes related to protein synthesis and energy metabolism. Eleven DEGs were randomly selected for qPCR verification and the results were consistent with the transcriptome analysis results. In summary, the transcriptome results differed significantly between seasons in the gill tissues of Neptunea cumingii. The expression levels of immune regulatory genes could be promoted in Neptunea cumingii during the high temperature season, whereas the expression of these genes may be inhibited in the low temperature season. The results obtained in this study provide insights into the molecular defense mechanisms that might allow Neptunea cumingii to adapt to climate change.

The unique characteristics of frescoes on overseas Chinese buildings can attest to the integration and historical background of Chinese and Western cultures. Reasonable analysis and preservation of overseas Chinese frescoes can provide sustainable development for culture and history. This research adopts the image analysis technology based on artificial intelligence, and proposes a ResNet-34 model and method integrating transfer learning. This deep learning model can identify and classify the source of the frescoes of the emigrants, and can effectively deal with the problems such as the small number of fresco images on the emigrants' buildings, poor quality, difficulty in feature extraction, and similar pattern text and style. The experimental results show that the training process of the model proposed in this article is stable. On the constructed Jiangmen and Haikou fresco JHD datasets, the final accuracy is 98.41%, and the recall rate is 98.53%. The above evaluation indicators are superior to classic models such as AlexNet, GoogLeNet, and VGGNet. It can be seen that the model in this article has strong generalization ability and is not prone to overfitting. It can effectively identify and classify the cultural connotations and regions of frescoes.

Recent research efforts in bone tissue engineering have been primarily directed towards manufacture-viable synthesis of biomaterials that can significantly enhance the biocompatibilities and osteogenic capabilities on the new biomaterials. This paper presents a straightforward, cost-effective, optimized, and well-controlled hydrothermal synthesis of Nb-doped potassium titanate nanofibers in high-purity. Characterization data revealed that the Nb-doping potassium titanate maintained the crystal structure, showing great promise for applications in bone tissue engineering.

Due to the extraordinary mechanical properties of ultra-high-performance concrete (UHPC), the shear stirrups in UHPC beams could potentially be removed. The aim of this study is to determine the effect of beam height and steel fiber volume content on the shear behavior of non-stirrup UHPC beams under a larger shear span-depth ratio (up to 2.8). Eight beams were designed and fabricated, including six non-stirrup UHPC beams and two comparing stirrup-reinforced normal concrete (NC) beams. The experimental results demonstrated that the volume content of steel fiber could be a crucial factor affecting the ductility, cracking strength, and shear strength of non-stirrup UHPC beams and altering their failure modes. Additionally, the height of the beam had a considerable effect on its shear resistance. This study revealed that the French standard formulae were more accurate for the UHPC beams with larger shear span-depth ratios and PCI-2021 formulae greatly overestimate the shear capacity of UHPC beams with larger shear span-depth ratios. Xu’s formulae were more accurate for the steel fiber-reinforced UHPC beams with larger shear span-depth ratios.

Examining the clustering characteristics and fluctuations within urban areas during peak hours through the lens of bike-sharing is of utmost importance in the optimization of bike-sharing systems and urban transportation planning. This investigation adopts the principles of urban spatial interaction network construction and employs streets as the fundamental units of analysis to model bike-sharing activities during morning and evening peak hours within Beijing's six central districts. Subsequent to this, a comprehensive analysis of the network's structural attributes was carried out. A walktrap method rooted in modularity analysis was introduced to discern and scrutinize the clustering patterns and characteristics of communities within the network across different temporal intervals. Empirical findings reveal a predominant usage pattern of shared bicycles for short-distance travel during both morning and evening peak hours. Notably, distinctive community structures manifest during these periods, characterized by two large communities and multiple smaller ones during the morning peak, while the evening peak showcases a single large community alongside several medium-sized and smaller ones. Moreover, the extended interaction radius points to an expanded geographic range of interactions among streets. These findings bear significant implications for the management of urban transportation, bike-sharing enterprises, and urban residents, proffering valuable insights for the optimization of bike-sharing schemes and transportation strategies.

As one of the fastest-growing new energy sources, wind power technology has attracted widespread attention from all over the world. In order to improve the quality of wind power generation, wind speed prediction is an indispensable task. In this paper, an error correction based Variational Mode Decomposition and Broad Learning System (VMD-BLS) hybrid model is proposed for wind speed prediction. First, the wind speed is decomposed into multiple components by the VMD algorithm, and then an ARMA model is established for each component to find the optimal number of sequence divisions. Second, the BLS model is used to predict each component, and the prediction results are summed to obtain the wind speed forecast value. However, in some traditional methods, there is always time lag, which will reduce the forecast accuracy. To deal with this, a novel error correction technique is developed by utilizing BLS. Through verification experiment with actual data, it proves that the proposed method can reduce the phenomenon of prediction lag, and can achieve higher prediction accuracy than traditional approaches, which shows our method’s effectiveness in practice.

Adopting banana peel as raw material, the adsorption properties of banana peel hydrothermal carbon modified with KOH solution for lead ions in aqueous solution were studied. The surface structure and functional groups of the modified hydrothermal carbon were analyzed by XRD and SEM. The results showed that the banana peel hydrothermal carbon prepared from 0.5 mol/L KOH solution had large pores, and its adsorption capacity reached 42.92 mg/g at a pH value of 6; When the concentration of KOH solution is 0.5 mol/L, the solid liquid ratio is 2 g/L, the adsorption capacity reaches 21.39 mg/g, and the adsorption rate reaches 82.74%; When the concentration of lead solution increased to 100 mg/L, the adsorption capacity of modified hydrothermal carbon for lead ions decreased to 78.26%; The equilibrium adsorption time of lead ion in solution on phosphoric acid modified hydrothermal carbon from banana peel was 250 minutes, and the adsorption process met the quasi second order kinetic model and Freundlich isotherm equation, with an equilibrium adsorption rate of 88.62%. The adsorption of lead ions in solution by KOH modified hydrothermal carbon is mainly chemical physical adsorption.

The effects of exogenous inorganic [i.e., nitrate (NO3-)/ammonium (NH4+)] and organic [i.e., glutamate (Glu)/argine (Arg)] N alone and in combination on the accumulation of proline (Pro) in rice plant under trivalent chromium [Cr(III)] stress were studied through the mass balance matrix model (MBMM). ‘NH4+’ application showed the largest contribution to the Pro content in rice shoots under different concentrations of Cr(III), followed by ‘NO3-’, ‘Arg’, and ‘Glu’ application respectively. While, ‘Arg’ application displayed the largest contribution to the Pro content in roots under Cr(III) stress, followed by ‘NH4+’, ‘Glu’, and ‘NO3-’ application. Among the combination cases of N sources used, the application of ‘NH4++Arg’ showed the greatest contribution to the Pro content in both roots and shoots of Cr(III)-treated rice seedlings, while the application of ‘NO3-+Glu’ showed the least contribution to the Pro content in rice seedlings under Cr(III) stress. Results from this study indicated that the level of indigenous Pro in rice seedlings is quite sensitive to Cr(III) stress under different N sources, and mathematical modeling showed a reliable result to estimate the relationship between Pro content and N source application in rice plants in response to Cr(III) exposure .

Accurate measurement of systemic financial risk is critical to maintaining the stability of financial markets. Taking China as the subject of investigation, the Chinese Financial Stress Index (CFSI) indicator system was con-structed by integrating six dimensions and employing Gray Relation Analysis (GRA) for dimensionality reduction of the indicators. The CFSI was derived using the Attribute Hierarchy Model (AHM) method with the Criteria Importance Through the Intercriteria Correlation (CRITIC) method, and an Improved Gravitational Search Algorithm (IGSA) optimized Radial Basis Function Neural Network (RBFNN) was proposed for out-of-sample prediction of CFSI trends from 2024 to 2026. By analyzing the trend of financial pressure indicators, the relationship between financial pressure and economic activity can be effectively identified. The research findings indicate that: (1) The CFSI is capable of accurately reflecting the current financial stress situation in China; (2) The IGSA-RBFNN demonstrates good robustness and generalization capabilities, predicting that the CFSI index will reach a peak value of 0.543 by the end of 2024, and there exists a regular pattern of stress rebound towards the end of each year. The novel methodology benefits policymakers and regulatory authorities to formulate preventive measures and risk management by identifying potential risks and vulnerabilities in advance.

The radar sensor described realizes healthcare monitoring capable of detecting subject chest-wall movement caused by cardiopulmonary activities, and wirelessly estimating the respiration and heartbeat rates of the subject without attaching any devices to the body. Conventional single-tone Doppler radar can only capture Doppler signatures because of a lack of bandwidth information with noncontact sensors. In contrast, we take full advantage of impulse radio ultra-wideband (IR-UWB) radar to achieve low power consumption and convenient portability, with a flexible detection range and desirable accuracy. A noise reduction method based on improved ensemble empirical mode decomposition (EEMD) and a vital sign separation method based on the continuous-wavelet transform (CWT) are proposed jointly to improve the signal-to-noise ratio (SNR) in order to acquire accurate respiration and heartbeat rates. Experimental results illustrate that respiration and heartbeat signals can be extracted accurately under different conditions. This noncontact healthcare sensor system proves the commercial feasibility and considerable accessibility of using compact IR-UWB radar for emerging biomedical applications.

MEMThe PdNi film hydrogen sensors with Wheatstone bridge structure were designed and fabricated by the micro-electro-mechanical system (MEMS) technology. The integrated sensors consisted of four PdNi alloy film resistors. The interval two of them were shielded with silicon nitride film and used as reference resistance, while the others were used for hydrogen sensing. The PdNi alloy films and SiN films were deposited by magnetron sputtering. The morphology and microstructure of the PdNi films were characterized with X-ray diffraction (XRD). The output resistance signal was converted to millivolt output voltage signal for easy data acquisition. Hydrogen (H2) sensing properties of PdNi film hydrogen sensor with Wheatstone bridge structure was investigated under different temperatures (30℃, 50℃ and 70℃) and H2 concentrations (from 10 ppm to 0.4%). The hydrogen sensor demonstrated good response at different hydrogen concentrations and high repeatability in cycle testing under 0.4% H2 concentration. Under 10ppm hydrogen, the PdNi film hydrogen sensor had evident and collectable output voltage of 600 μV.

Semi-continuous data are very common in the social science and economics. In this paper, a Bayesian variable selection procedure is developed to assess the influence of exogenous factors including observed and unobserved on the semi-continuous data. Our formulation is based on the two-part latent variable model with polytomous response. We consider two schemes for the penalties of regression coefficients and factor loadings: the Bayesian spike and slab bimodal prior and the Bayesian lasso prior. Within the Bayesian framework, we implement Markov Chains Monte Carlo sampling method to conduct posterior inference. To facilitate posterior sampling, we recast the logistic model in part one as the norm-like mixture model. Gibbs sampler is designed to draw observations from the posterior. Our empirical results show that with suitable hyper-parameters, the spike and slab bimodal method slightly outperforms the Bayesian lasso in the current analysis. Finally, a real example related to the China household finance survey is analyzed to illustrate the application of the methodology.. .

A complex square matrix $A$ is said to be Hermitian if $A= A^{\ast}$, the conjugate transpose of $A$. The topic of the present note is concerned with the characterization of Hermitian matrix. In this note, the we show that each of the two triple matrix product equalities $AA^{\ast}A = A^{\ast}AA^{\ast}$ and $A^3 = AA^{\ast}A$ implies that $A$ is Hermitian by means of decompositions and determinants of matrices, which are named the two-sided removal and cancellation laws associated with Hermitian matrix, respectively. We also present several general removal and cancellation laws as the extensions of the preceding two facts about Hermitian matrix.

Previous camera self-calibration methods have exhibited certain notable shortcomings. On one hand, they either exclusively emphasized scene cues or solely focused on vehicle-related cues, resulting in a lack of adaptability to diverse scenarios and a limited number of effective features. Furthermore, these methods either solely utilized geometric features within traffic scenes or exclusively extracted semantic information, failing to comprehensively consider both aspects. This limited the comprehensive feature extraction from scenes, ultimately leading to a decrease in calibration accuracy. Additionally, conventional vanishing point-based self-calibration methods often required the design of additional edge-background models and manual parameter tuning, thereby increasing operational complexity and the potential for errors. Given these observed limitations, and in order to address these challenges, we propose an innovative roadside camera self-calibration model based on the Transformer architecture. This model possesses a unique capability to simultaneously learn scene features and vehicle features within traffic scenarios while considering both geometric and semantic information. Through this approach, our model can overcome the constraints of prior methods, enhancing calibration accuracy and robustness while reducing operational complexity and the potential for errors. Our method outperforms existing approaches on both real-world dataset scenarios and publicly available datasets, demonstrating the effectiveness of our approach.

Notch signaling is a highly conserved pathway which occurs between adjacent cells to distinguish them. The Notch signaling cascade operates in a simple mechanism, yet Notch plays remarkably diverse roles in development to regulate cell fate determination, organ growth and tissue patterning. Originally isolated and characterized in the model insect Drosophila melanogaster, recent studies in various insect species have revealed that Notch signaling is broadly involved in the construction of insect tissues. This review focuses on providing a molecular mechanistic and developmental picture regarding the roles of Notch pathway in insects. The functions of Notch in the formation and patterning of insect embryo, wing, leg, ovary and several specific structures as well as in stress responses are summarized. These results are discussed in developmental context with an eye toward understanding the functionality of Notch signaling pathway in different insect species.

In this study, Li-Al-OH layered double hydroxide (LDH), which was prepared by solvent-free one-step mechanochemical reaction of LiOH and Al(OH)₃, was applied to remove boron from aqueous solution. Dry-grinding for 3 h at a rotational speed of 500 rpm, Li/Al molar 1/2 was the optimum condition to prepare highly crystalline of Li-Al LDH phase with no evident impure phases. Two milling products with Li/Al molar ratio at 1/2 and 2/2 were evaluated for boron adsorption. The results confirmed that Li/Al molar ratio 2/2 sample showed high boron adsorption capacity due to the physical adsorption of Li-Al-OH LDH and chemical synergism of phase gel Al(OH)₃. The adsorption isotherms, described by the Langmuir model, indicated maximum monolayer boron uptake capacity 45.45 mg/g, implying competitive adsorption capacity of the material in our experiment.

Factorization reduces computational complexity and is therefore an important tool in statistical machine learning of high dimensional systems. Conventional molecular modeling, including molecular dynamics and Monte Carlo simulations of molecular systems, is a large research field based on approximate factorization of molecular interactions. Recently, the local distribution theory was proposed to factorize global joint distribution of a given molecular system into trainable local distributions. Belief propagation algorithms are a family of exact factorization algorithms for trees and are extended to approximate loopy belief propagation algorithms for graphs with loops. Despite the fact that factorization of probability distribution is their common foundation, computational research in molecular systems and machine learning studies utilizing belief propagation algorithms have been carried out independently with respective track of algorithm development. The connection and differences among these factorization algorithms are briefly presented in this perspective, with the hope to intrigue further development in factorization algorithms for physical modeling of complex molecular systems.

Cyberspace map, as one of the important tools to describe cyberspace, gives an image to the unpredictable and illusory cyberspace, and has become a research hotspot in the fields of cartography, cyberspace security. Clarifying the concept of cyberspace map and constructing the conceptual model of cyberspace map can promote people's unified cognition of cyberspace. Based on the view of cartography, this paper compares and analyzes some related concepts of cyberspace map, discusses the characteristics of cyberspace map，and gives its concept. After that, it analyzes people's cognition of cyberspace composition. On this basis, it caters to this cognition mode and proposes the conceptual model of cyberspace map. Then, the connotation of the model is elaborated from three aspects: element-space association dimension, element mapping dimension and the map representation dimension. Finally, the specific composition and symbolization of various elements are analyzed. The model provides the top-level framework and theoretical guidance for the research of cyberspace map. This paper aims to adapt to the development trend of Cartography in ternary space, clarify the basic concept of cyberspace map, promote the development of cyberspace mapping theory, and lay the foundation for subsequent research.

Digital Elevation Models (DEMs) are widely used in geographic and environmental studies. In the current work, the fusion of multi-source DEMs is investigated to improve the overall accuracy of public domain DEMs. Multi-scale decomposition is an important analytical method in data fusion. Three multi-scale decomposition methods – the wavelet transform (WT), bidimensional empirical mode decomposition (BEMD) and nonlinear adaptive multi-scale decomposition (N-AMD) - are applied to the 1-arc-second Shuttle Radar Topography Mission Global digital elevation model (SRTM-1 DEM) and the Advanced Land Observing Satellite World 3D – 30 m digital surface model (AW3D30 DSM) in China. Of these, the WT and BEMD are popular image fusion methods. A new approach for DEM fusion is developed using N-AMD (which is originally invented to remove the cycle from sunspots). Subsequently, a window-based rule is proposed for the fusion of corresponding frequency components obtained by these methods. Quantitative results show that N-AMD is more suitable for multi-scale fusion of multi-source DEMs, taking the ice cloud and land elevation satellite (ICESat) global land surface altimetry data as a reference. The vertical accuracy of the fused DEM shows significant improvements of 29.6% and 19.3% in a mountainous region and 27.4% and 15.5% in a low-relief region, compared to the SRTM-1 and AW3D30 respectively. Furthermore, a slope position-based linear regression method is developed to calibrate the fused DEM for different slope position classes, by investigating the distribution of the fused DEM error with topography. The results indicate that the accuracy of the DEM calibrated by this method is improved by 16% and 13.6%, compared to the fused DEM in the mountainous region and low-relief region respectively, proving that it is a practical and simple means of further increasing the accuracy of the fused DEM.

This note addresses a fundamental problem in matrix theory on establishing and characterizing range equalities for matrix expressions that involve generalized inverses. We first establish a group of necessary and sufficient conditions for the matrix range equality ${\rm range}(D_1 - C_1A_1^{\dag}B_1) = {\rm range}(D_2 - C_2A_2^{\dag}B_2)$ to hold, where $(\cdot)^{\dag}$ denotes the Moore--Penrose inverse of matrix. We then give several groups of range equalities with extrusion properties for multiple matrix products associated with two matrices and their conjugate transposes and Moore--Penrose inverses.

3,4-Dihydroquinolin-2(1H)-ones represent a class of valuable bioactive compounds with six-membered nitrogen-containing heterocyclic structures. The development of simple, mild and efficient synthetic methods has been widely concerned by synthetic chemists. In this review, we have summarized a series of different synthetic strategies for the synthesis of dihydroquinoline-2(1H)-ones via catalytic annulation of α,β-unsaturated N-arylamides in the past decade, including covering electrophilic cyclization, radical initiated cyclization and photochemical cyclization reactions. Besides, the substrate scope and mechanistic details are also discussed. This paper will provide a useful reference for the development of diverse synthesis methodologies of 3,4-dihydroquinolin-2(1H)-ones.

Perennial cropping play vital roles in regulating soil carbon sequestration and thus mitigating climate change. However, how perennial cropping affects soil microbial community remains elusive. Using a field investigation, this study was conducted to examine the effects of mugwort cropping along a chronosequence (that is, wheat-maize rotation, 3-year, 6-year, and 20-year mugwort cropping) on soil microbial community in temperate regions of Northern China. The results showed that the highest total, actinomycetes, and fungi PLFAs were found in the 3-year mugwort cropping soils. All PLFAs of microbial groups were lowest in the 20-year mugwort cropping soils. All of the three cropping years of mugwort increased network complexity of soil microbial community. Changes in total nitrogen and phosphorus content as well as the ratio of ammonium nitrogen to nitrate nitrogen could be primarily explain the variations in soil microbial community along the mugwort cropping chronosequence. Our observations highlight the contrasting impacts of soil microbial community to short-term and long-term mugwort cropping compared to conventional rotations and would have critical implications for sustainable agricultural management under perennial cropping in temperate regions.

TP53 is a tumor suppressor gene that encodes a sequence-specific DNA-binding transcription factor activated by stressful stimuli and upregulates target genes involved in growth suppression, cell death, DNA repair, metabolism, among others. P53 is the most frequently mutated gene in tumors with mutations not only leading to loss-of-function (LOF), but also gain-of-function (GOF) which promotes tumor progression, and metastasis. The tumor-specific status of mutant p53 protein has suggested it is a promising target for cancer therapy. We summarize the current progress of targeting wild-type and mutant p53 for cancer therapy through biotherapeutic and biopharmaceutical methods for 1) boosting p53 activity in cancer, 2) p53-dependent and p53-independent strategies for targeting p53 pathway functional restoration in p53-mutated cancer, 3) targeting p53 in immunotherapy, and 4) combination therapies targeting p53, p53 checkpoints, or mutant p53 for cancer therapy.

Using banana peel as raw material, the adsorption properties of hydrothermal carbon pre-10 pared from banana peel modified with different concentrations of phosphoric acid solution for lead 11 ions in aqueous solution were studied. The surface structure and functional groups of the modified 12 hydrothermal carbon were analyzed by XRD and SEM. The results show that the surface of the 13 modified banana peel hydrothermal carbon prepared at 240℃ and 2mol/L phosphoric acid solution 14 has large pores. The adsorption capacity is larger when pH value is 6.When the concentration of 15 phosphoric acid solution was 2mol/L, the solid-liquid ratio was 2g/L, the adsorption capacity was 16 40.64mg/g, and the removal rate was 82.74%.When the initial concentration of lead solution in-17 creased to 100mg/L, the adsorption capacity of modified hydrothermal carbon for lead ion increased 18 to 76.81mg/g, and the removal rate decreased to 76.81%.The equilibrium adsorption time of banana 19 peel phosphoric acid modified hydrothermal carbon for lead ions in solution is 300min. The adsorp-20 tion process satisfies the pseudo-second-order kinetic model and Langmuir isotherm equation. The 21 reaction temperature is 313K, and the equilibrium adsorption capacity can reach 101.19mg/g. The 22 adsorption of Pb ions in aqueous solution by phosphoric acid modified hydrothermal carbon is 23 dominated by single layer chemisorption. The artificial neural network has a fitting correlation of 24 0.99, and the adsorption process includes physical adsorption, electrostatic attraction, ion exchange, 25 and surface complexation.

This article shows how to establish expansion formulas for calculating the mixed operations $(A^{\dag})^{\#}$, $(A^{\#})^{\dag}$, $((A^{\dag})^{\#})^{\dag}$, $((A^{\#})^{\dag})^{\#}$, $\ldots$ of generalized inverses, where $(\cdot)^{\dag}$ denotes the Moore--Penrose inverse of a matrix and $(\cdot)^{\#}$ denotes the group inverse of a square matrix. As applications of the formulas obtained, the author constructs and classifies some groups of matrix equalities involving the above mixed operations, and derives necessary and sufficient conditions for them to hold.

Conservation tillage and deep side-fertilization both hold the potential to reduce nitrogen leaching and improve grain yield and nitrogen use efficiency in fragrant rice cultivation practices. However, the combined impact of different tillage practices with deep side-fertilization on nitrogen leaching remains uncertain. Therefore, this study conducted on-site experiments for four rice growing seasons in both early and late seasons in 2018 and 2019, using the fragrant rice varieties "Meixiangzhan 2"(MX) and "Xiangyaxiangzhan"(XY). The four experimental treatments included:conventional tillage with regular fertilization (T1), conventional tillage with simultaneous deep fertilization (T2), reduced tillage with simultaneous deep fertilization (T3) , and no-tillage with simultaneous deep fertilization (T4). Our results indicate that the T4 treatment exhibited higher nitrogen leaching rates and potential nitrogen losses throughout the entire rice growth cycle, with a 4.51% increase in total nitrogen leaching and a 1.86% increase in potential nitrogen leaching compared to T1. In contrast, the T2 treatment demonstrated the lowest nitrogen leaching rate, resulting in a 6.01% reduction in total nitrogen leaching and a 9.57% decrease in potential nitrogen leaching compared to T1, demonstrating the most optimal performance. For MX, the T1 treatment resulted in lower daily grain outputs compared to the other treatments, with disparities ranging from 5.35% to 9.94%. Similarly, for the XY, the T1 treatment yielded significantly lower daily grain outputs compared to the other treatments, with discrepancies ranging from 6.26% to 10.81% during the late season of 2019. Overall, this study shows that conventional tillage with deep fertilization effectively reduces nitrogen leaching and boosts fragrant rice yields. Minimizing nitrogen leaching enhances nitrogen utilization efficiency. These insights highlight the significance of strategic fertilization and cultivation for environmental conservation and agricultural sustainability.

One of matrix equalities composed of multiple products of matrices and their generalized inverses is given by $A_1B_1^{-}A_2B_2^{-} \cdots A_kB_k^{-}A_{k+1}= A$ where $A_1$, $B_1$, $A_2$, $B_2$, $\ldots$, $A_k$, $B_k$, $A_{k+1}$, and $A$ are given matrices of appropriate sizes, and $B_1^{-}$, $B_2^{-}$, $\cdots$, $B_k^{-}$ are generalized inverses of matrices. The cases for $k = 1, 2$ and their special forms were properly approached in the theory of generalized inverses of matrices. In this note, the author presents an algebraic procedure to derive explicit necessary and sufficient conditions for the equality with $k = 3$ to always hold using certain rank equalities for the block matrices constructed by the given matrices, and then mention a key step of extending the previous work to a general situation.

Given a square matrix $A$, we are able to construct numerous equalities that involve reasonable mixed operations of $A$ and its conjugate transpose $A^{\ast}$, Moore--Penrose inverse $A^{\dag}$, and group inverse $A^{\#}$. Such kind of equalities can be generally represented in the equation form $f(A, \, A^{\ast}, A^{\dag}, A^{\#}) =0$. In this article, the author constructs a series of simple or complicated matrix equalities, as well as matrix rank equalities involving the mixed operations of the four matrices. As applications, we give a sequence of necessary and sufficient conditions for a square matrix to be range-Hermitian.

Kronecker products of matrices have some striking operation properties, one of which is called the mixed-product property $(A \!\otimes\! B)(C \!\otimes\! D) = AC \!\otimes\! BD$. In view of this property, the two-term Kronecker product $A_1 \otimes A_2$ can be rewritten as $A_1 \otimes A_2 = (A_1 \otimes I_{m_2})(I_{m_1} \otimes A_2)$ of dilation forms of $A_1$ and $A_2$, and three-term Kronecker product $A_1 \otimes A_2 \otimes A_3$ can be rewritten as the products $A_1 \otimes A_2 \otimes A_3 = (A_1\otimes I_{m_2} \otimes I_{m_3})(I_{m_1} \otimes A_2 \otimes I_{m_3})(I_{m_1} \otimes I_{m_2} \otimes A_3)$ of the dilation forms of $A_1$, $A_2$, and $A_3$, respectively, where the matrices on the right-hand sides of the two factorizations are commutative. In this note, we approach the commutative Kronecker products on the right-hand sides of the two factorization equalities, and present a variety of new and useful analytical formulas for calculating the ranks, dimensions, orthogonal projectors, and ranges of matrices composed of these Kronecker products.

This note reconsiders a matrix equality $A_1A_2^{-}A_3A_4^{-}A_5 = A$ composed by six matrices of appropriate sizes, where $A_2^{-}$ and $A_4^{-}$ are generalized inverses of $A_2$ and $A_4$, respectively, and solves a selection of matrix set inclusion problems associated with various mixed reverse order laws for generalized inverses of products of two, three, and four matrices by means of this equality and its variations.

The integration of deep neural networks into sparse Synthetic Aperture Radar (SAR) imaging has been explored to enhance SAR imaging performance and reduce the system’s sampling rate. However, the scarcity of training samples and mismatches between the training data and the SAR system pose significant challenges to the method’s further development. In this paper, we propose a novel SAR imaging approach based on Deep Image Prior Powered by RED (DeepRED), enabling unsupervised SAR imaging without the need for additional training data. Initially, DeepRED is introduced as the regularization technique within the sparse SAR imaging model. Subsequently, variable splitting and the Alternating Direction Method of Multipliers (ADMM) are employed to solve the imaging model, alternately updating the magnitude and phase of the SAR image. Additionally, the SAR echo simulation operator is utilized as an observation model to enhance computational efficiency. Through simulations and real data experiments, we demonstrate that our method maintains imaging quality and system downsampling rate on par with deep neural network-based sparse SAR imaging, but without the requirement for training data.

An experiment was conducted to investigate the role of single nucleotide polymorphisms of the gene RNF34 3′UTR-588 G>A and RNF128 I1-2380C>T with carcass and meat quality traits of Chinese Simmental-cross steers. METHOD: We performed sequencing and restriction enzyme digestion to detect genotypes of RNF34 3′UTR-588 G>A and RNF128 I1-2380C>T. Then, we analyzed the association of novel single nucleotide polymorphisms in intron regions of the RNF128 gene and in the 3′UTR region of RNF34 and meat quality traits of Chinese Simmental-cross steers. RESULTS: Statistical analyses revealed that SNP of RNF128 (I1-2380C>T) was significantly associated with dressed weight, forepaw weight, carcass depth, carcass brisket depth, hind legs length (P<0.05), etc. And RNF34 (3′UTR-588 G>A) were significantly associated with testis weight, kidney weight, tare weight (P<0.05), etc. CONCLUSION: Our findings suggest that polymorphisms in RNF34 and RNF128 might be important genetic factors that influence carcass and meat quality in beef cattle. Thus, they might be useful markers for meat quality traits in future marker-assisted selection programs in beef cattle breeding and production.

It is a classic topic in algebras to construct and verify equalities that are composed of various algebraic operations of elements and their inverses or generalized inverses. In this note, the author constructs a matrix equality $(AB)^{\dag} = B^{\ast}(A^{\ast}ABB^{\ast})^{\#}A^{\ast}$ (called a mixed reverse-order law), where $A$ and $B$ are two matrices of appropriate sizes, $(\cdot)^{\ast}$, $(\cdot)^{\dag}$, and $(\cdot)^{\#}$ denote the conjugate transpose, the Moore--Penrose inverse, and the group inverse of a matrix, respectively, and shows that the mixed reverse-order law always holds. A list of variation forms of this matrix equality are also given, and necessary and sufficient conditions are obtained for them to hold. Especially, we show a remarkable fact that the two reverse-order laws $(AB)^{\dag} = B^{\dag}A^{\dag}$ and $(A^{\ast}ABB^{\ast})^{\#} = (BB^{\ast})^{\#}(A^{\ast}A)^{\#}$ are equivalent.

Reverse order laws for generalized inverses of matrix products is a classic object of study in the theory of generalized inverses. One of the well-known reverse order laws for a matrix product $AB$ is $(AB)^{(i,\ldots,j)} = B^{(s_2,\ldots,t_2)}A^{(s_1,\ldots,t_1)}$, where $(\cdot)^{(i,\ldots,j)}$ denotes an $\{i,\ldots, j\}$-generalized inverse of matrix. Because $\{i,\ldots, j\}$-generalized inverse of a singular matrix is unique, the relationships between both sides of the reverse order law can be divided into four situations for consideration. This paper provides a thorough coverage of the reverse order laws for $\{i,\ldots, j\}$-generalized inverses of $AB$, from the development of background and preliminary tools to the collection of miscellaneous formulas and facts on the reverse order laws in one place with cogent introduction and references for further study. We begin with the introduction of a linear mixed model $y = AB\beta + A\gamma + \epsilon$ and the presentation of two least-squares methodologies to estimate the fixed parameter vector $\beta$ in the model, and the description of connections between the two types of least-squares estimators and the reverse order laws for generalized inverses of $AB$. We then prepare some valued matrix analysis tools, including a general theory on linear or nonlinear matrix identities, a group of expansion formulas for calculating ranks of block matrices, two groups of explicit formulas for calculating the maximum and minimum ranks of $B^{(s_2,\ldots,t_2)}A^{(s_1,\ldots,t_1)}$, as well as necessary and sufficient conditions for $B^{(s_2,\ldots,t_2)}A^{(s_1,\ldots,t_1)}$ to be invariant with respect to the choice of $B^{(s_2,\ldots,t_2)}A^{(s_1,\ldots,t_1)}$. We then present a unified approach to the 512 matrix set inclusion problems associated with the above reverse order laws for the eight commonly-used types of generalized inverses of $A$, $B$, and $AB$ through use of the definitions of generalized inverses, the block matrix method (BMM), the matrix rank method (MRM), the matrix equation method (MEM), and various algebraic calculations of matrices.

The relative position of the orchard robot to the rows of fruit trees is an important parameter for achieving autonomous navigations. The current methods for estimating the position parameters between rows of orchard robots obtain low parameter accuracy, and to address this problem, this paper proposes a machine vision-based method for detecting the relative position of orchard robots and fruit tree rows. Firstly, the fruit tree trunk is identified based on the improved YOLOv4 model; secondly, the camera coordinates of the tree trunk are calculated from the principle of binocular camera triangulation, and the ground projection coordinates of the tree trunk are obtained through coordinate conversion; finally, the midpoints of the projection coordinates of different sides are combined and the navigation path is obtained by linear fitting with the least squares method, and the position parameters of the orchard robot are obtained through calculation. The experimental results show that the average accuracy and average recall of the improved YOLOv4 model for fruit tree trunk detection are 97.05% and 95.42%, respectively, which are 5.92 and 7.91 percentage points higher than those of the original YOLOv4 model. The average errors of heading angle and lateral deviation estimates obtained based on the method in this paper are 0.57° and 0.02 m. The method can accurately calculate heading angle and lateral deviation values at different positions between rows, and can provide a reference for autonomous visual navigation of orchard robots.

Cordycepin has good antitumor activity, but its clinical application is limited due to the easy deamination of N6 in structure. In this study, a large lipopolysis group was introduced at the cordycepin N6 to improve the problem, Cordycepin derivatives(3a-4c) were synthesized, and biological evaluation of compounds were studied. In the study, the vitro antitumor activity of the compounds against MCF7 cells, HepG2 cells and SGC-7901 cells was evaluated by MTT assay. In the results, compound 4a showed the most obvious inhibitory effect on MCF7 cells with IC50 value of 27.566±0.52 μM, which was much lower than cordycepin. Compound 4a showed high selectivity between MCF7 and normal MCF-10A cells. Further biological evaluation showed that compound 4a promoted apoptosis and blocked the cell cycle in G0/G1 phase. Then, Western Blot was used to detect related apoptotic proteins. It was found that Compound 4a could down-regulate the expression of Bcl-2 protein and up-regulate the expression of p53, Bax, Caspase-3, and Caspase-9 proteins. The mitochondrial membrane potential decreased continuously and the positive expression rate decreased. It was speculated that compound 4a induced the apoptosis of MCF7 cells through the mitochondrial pathway.

The basic idea is to expand the completed zeta function $\xi(s)$ in MacLaurin series (infinite polynomial), which can be further expressed as infinite product (Hadamard product) by conjugate complex roots. Finally, the functional equation $\xi(s)=\xi(1-s)$ leads to $(s-\alpha_i)^2 = (1-s-\alpha_i)^2, i \in \mathbb{N}$ with solution $\alpha_i= \frac{1}{2}, i \in \mathbb{N}$, where $\alpha_i$ are the real parts of the zeros of $\xi(s)$, i.e., $s_i =\alpha_i\pm j\beta_i, i\in \mathbb{N}$. Therefore, a proof of the Riemann Hypothesis is achieved.

Improved understanding of climate-growth relationships of multi-species is fundamental to understand and predict response of forest growth to future climate change. Forests are mainly composed of conifers in Northwestern Yunnan Plateau, but variations of growth response to climates among the species are not well understood. To detect growth response of multiple species to climate change, we developed residual chronologies of four major conifers, i.e. Abies georgei, Picea likiangensis, Pinus densata and Larix potaninii at upper distributional limits in Shika Snow Mountain. By using dendroclimatology method, we analyzed correlations between the residual chronologies and climate variables. The results showed that conifer radial growth was influenced by both temperature and precipitation in Shika Snow Mountain. Previous November temperature, previous July mean maximum temperature (T_max) and current June precipitation were the common climatic factors, which had consistent influences on radial growth of four species. Temperature in previous post growing season (September–October) and current growing season (June-August), and precipitation in previous August were the common climatic factors, which had divergent impacts on four species radial growth. Current May T_max and early growing season (April-May) precipitation showed positive and negative influences on growth of P. likiangensis, respectively. Temperature in current post growing season positively affected growth of A. georgei. According to the prediction of climate models and our understanding in growth response of four species to climate variables, we may understand growth response to climate change at species level. It is difficult to predict future forest growth in the study area, since future climate change might cause both increases or decreases for four species and indirect effects of climate change on forest should be considered.

Novel collector lead(II)-benzohydroxamic acid (Pb(II)-BHA) complexes in aqueous solution were characterized by using experimental approaches, including Ultraviolet-visible (UV-Vis) spectroscopy and electrospray ionization–mass spectrometry (ESI-MS), as well as first-principle density functional theory (DFT) calculations with consideration for solvation effects. The Job plot delineated that a single coordinated Pb(BHA)⁺ should be formed first, and the higher coordination number complexes can be formed subsequently. Moreover, the Pb(II)-BHA species can aggregate with each other to form complicated structures, such as Pb(BHA)₂ or highly complicated complexes. ESI-MS results validated the existence of Pb-(BHA)_n=1,2 under different solution pH values. Further, the first-principles calculations suggested that Pb(BHA)⁺ should be the most stable structure, and the Pb atom in Pb(BHA)⁺ will act as an active site to attack nucleophiles. These findings are meaningful to further illustrate the adsorption mechanism of Pb(II)-BHA complexes in mineral processing.

Quality assurance has been one of the major challenges in laser-based additive manufacturing (AM) processes. This study proposes a novel process modeling methodology for layer-wise in-situ quality monitoring based on image series analysis. An image-based autoregressive (AR) model has been proposed based on the image registration function between consecutively observed thermal images. Image registration is used to extract melt pool location and orientation change between consecutive images, which contains sensing stability information. Subsequently, a Gaussian process model is used to characterize the spatial correlation within the error matrix. Finally, the extracted features from the aforementioned processes are jointly used for layer-wise quality monitoring. A case study of a thin wall fabrication by a Directed Laser Deposition (DLD) process is used to demonstrate the effectiveness of the proposed methodology.

Achieving sustainable management of forests in China is becoming increasingly important with more awareness and realization of the importance of forests in environmental protection. Forest certification, a market-based instrument to promote sustainable forest management, has been recognized by many countries including China. While landowners’ perception and perspective regarding this voluntary program have been well-documented in literature, how to motivate and incentivize landowners to participate in forest certification remained under-studied questions. With the face-to-face survey of landowners in Shandong, China, this study analyzed landowners’ willingness to accept compensation for participating in forest certification. Results indicated that landowners average accepted compensation, in terms of increased timber price, was about RMB120 (~$17.2)/m3 to have their forests certified. Results from multiple regression showed that the level of such compensation required for certification adoption was influenced by ownership size, owners’ demographics, certification program requirements, as well as importance placed on timber sale. These findings would inform policy-makers in designing compensation-related polices and establish incentive-based mechanisms to motivate landowners participate in forest certification programs in China.

Trueperella pyogenes (T. pyogenes) can cause a variety of infections in animals and lead to economic loss in animal husbandry. TatD DNases are considered to be potential virulence factors in Plasmodium falciparum and Streptococcus pneumoniae. However, the function of TatD DNases in T. pyogenes is still unclear. Therefore, the aim of this study was to illustrate the function of TatD DNases of T. pyogenes (TpTatDs) and investigate whether luteolin is able to inhibit DNase function. The findings of our study are anticipated to be crucial to treating infections caused by T. pyogenes. Bioinformatic analysis has been used for the prediction of crucial functional residues of TpTatDs. The function of TpTatDs was investigated in the presence of divalent cations by hydrolyzing DNA with recombinant TatD proteins. Luteolin is a candidate nuclease inhibitor evaluated in our study. The interactions between luteolin and TpTatDs were tested using molecular docking analysis and surface plasmon resonance (SPR) assays. The inhibitory effect of luteolin on TpTatDs was analyzed by agarose gel electrophoresis. Two genes in the genome of T. pyogenes are suspected to encode TatD DNases. According to the length of their nucleotide sequences, they were named tatD960 and tatD825. Both of the TpTatDs, which are magnesium-dependent, were able to hydrolyze linear DNA and plasmids. In this study, we found through molecular docking analysis and SPR assays that luteolin can stably bind with TpTatDs. The gel assay revealed that luteolin can inhibit the DNase activity of TpTatDs. Our results indicated that TatD DNases from T. pyogenes are Mg2+-dependent DNases and exhibit DNA endonuclease activity. Moreover, luteolin reduced their DNA hydrolysis ability by decreasing the binding between TpTatDs and DNA.

Utilizing deep learning for semantic segmentation of cropland from remote sensing imagery has become a crucial technique in land surveys. Cropland illustrates diverse morphologies and degrees of fragmentation on the Earth’s surface, underscoring the importance of accurately perceiving the complex boundaries of cropland which are crucial for effective segmentation. This paper introduces a UNet-like boundary-aware compensation model BAFormer. Cropland boundaries typically exhibit rapid transformations in pixel values and texture features, often appearing as high-frequency features in remote-sensing images. To enhance the recognition of these high-frequency features as represented by cropland boundaries, the proposed BAFormer integrates a Feature Adaptive Mixer (FAM) and develops a Deep Wide Large Kernel Multi-Layer Perceptron (DWLK-MLP) to enrich the global and local cropland boundaries features separately. Specifically, FAM adaptively mixes high-frequency and low-frequency features through the advantages of convolution and self-attention; DWLK-MLP expands the convolutional receptive field by deeply decomposing large kernel convolutions. The efficacy of BAFormer has been evaluated on the Vaihingen, Potsdam, and LoveDA public datasets, as well as the Mapcup dataset. It has demonstrated advanced performance, achieving mIoU scores of 84.5%, 87.3%, 53.5%, and 83.1% on these datasets respectively. Notably, BAFormer-T, the lightweight iteration of the model, surpasses other lightweight models on the Vaihingen dataset with scores of 91.3% F1 and 84.1% mIoU. The source code is available at https://github.com/WangYouM1999/BAFormer.

Molecular modeling is widely utilized in subjects including but not limited to physics, chemistry, biology, materials science and engineering. Impressive progress has been made in development of theories, algorithms and software packages. To divide and conquer, and to cache intermediate results have been long standing principles in development of algorithms. Not surprisingly, Most of important methodological advancements in more than half century of molecule modeling are various implementations of these two fundamental principles. In the mainstream classical computational molecular science based on force fields parameterization by coarse graining, tremendous efforts have been invested on two lines of algorithm development. The first is coarse graining, which is to represent multiple basic particles in higher resolution modeling as a single larger and softer particle in lower resolution counterpart, with resulting force fields of partial transferability at the expense of some information loss. The second is enhanced sampling, which realizes "dividing and conquering" and/or "caching" in configurational space with focus either on reaction coordinates and collective variables as in metadynamics and related algorithms, or on the transition matrix and state discretization as in Markov state models. For this line of algorithms, spatial resolution is maintained but no transferability is available. Deep learning has been utilized to realize more efficient and accurate ways of "dividing and conquering" and "caching" along these two lines of algorithmic research. We proposed and demonstrated the local free energy landscape approach, a new framework for classical computational molecular science and a third class of algorithm that facilitates molecular modeling through partially transferable in resolution "caching" of distributions for local clusters of molecular degrees of freedom. Differences, connections and potential interactions among these three algorithmic directions are discussed, with the hope to stimulate development of more elegant, efficient and reliable formulations and algorithms for "dividing and conquering" and "caching" in complex molecular systems.

Poor interlaminar fracture toughness has been a major issue in glass fiber-reinforced epoxy resin (GF/EP) laminate composites. In this paper, soft carboxy-terminated liquid nitrile (CTBN) rubber particles and rigid nano-SiO2 are used to toughen the epoxy resin (EP) matrix to improve the interlayer properties of GF/EP laminate composites. The effects of adding two toughening agents on the mechanical and interlayer properties of GF/EP laminates were studied. The results showed that adding the two kinds of particles improved the mechanical properties of the epoxy matrix. When the additional amount of flexible CTBN rubber particles was 8wt%, and the rigid nano SiO2 was 0.5wt%, the fracture toughness of the matrix resin was increased by 215.8%, and the tensile strength was only decreased by 2.3% compared with the pure epoxy resin. On this basis, the effects of two kinds of particles on the interlayer properties of GF/EP composites were studied. Compared with the unmodified GF/EP laminates, the interlayer shear strength and mode Ⅰ interlayer fracture toughness is significantly improved by toughening agent, and the energy release rate GIC of interlayer shear strength and interlayer fracture toughness is increased by 109.2%, and 86.8%, respectively.

In the full load operating range, wind turbines typically use pitch control to maintain rotor speed and output power at their rated values to guarantee the whole system’s safety. Blade pitch actuators are subject to physical limitations and safety requirements, which imposes strict constraints on pitch angle’s amplitude and rate of change. These constraints will bring windup problem to the integral part of the pitch controller. It leads to deterioration of the pitch control system’s performance or even the instability problem, especially for large-scale turbines operating in extreme uncertain wind conditions or suffering from cyber attacks. This paper designs an anti-windup robust pitch angle control strategy to deal with pitch rate constraint issue to enhance the security of control system. First, to facilitate controller design, a filtered tracking error technique is employed to transform the nonaffine form into an affine one. Subsequently, a feedback robust controller based on UDE is developed to handle the model’s uncertainty and external disturbances. To address the issue of integral saturation in the pitch system and guarantee its safety, an elliptical bounded constraint is integrated into the designed UDE strategy. This bounded UDE controller can improve the stability of power generation quality, reduces the mechanical loads on components and enhance the whole system’s safety. Finally, the effectiveness of the proposed scheme is verified on the Wind Turbine Blockset platform in Matlab/Simulink. It can achieve better performance than the traditional method.

Engineering of quantum computers requires reliable characterization of qubits, quantum operations, and even the entire hardware. Quantum tomography is an indispensable framework in quantum characterization, verification, and validation (QCVV), which has been widely accepted by researchers. According to the tomographic target, quantum tomography can be categorized into quantum state tomography (QST), quantum process tomography (QPT), gate set tomography (GST), process tensor tomography (PTT), and instrument set tomography (IST). Standard quantum tomography toolkits generally consist of basic linear inverse methods and statistical maximum likelihood estimation (MLE) based methods. Furthermore, the performance of standard methods, including effectiveness and efficiency, has been further developed by exploiting Bayesian estimation, neural networks, matrix completion techniques, etc. In this review, we introduce the fundamental quantum tomography techniques, including QST, QPT, GST, PTT, and IST. We first introduce the details of basic linear inverse methods. Then, the framework of MLE methods with constraints is summarized. Finally, we briefly introduce recent further research in developing the performance of tomography. This review provides a primary getting-start in developing quantum tomography, which promotes quantum computer development.

As one of the important components of underwater propulsion systems, water lubricated bearings are often failure due to mechanical wearing and vibrating, especially under high loads and prolonged friction. In this paper, a dual-network co-crosslinking strategy based on HNBR is proposed, in which the epoxy network connects with the rubber network through Epoxidized Eommia ulmoides gum. The damping, tribological and mechanical properties of the prepared composite are systematically investigated. The results show that this material has excellent friction and vibration damping properties, with a water-lubricated coefficient of friction as low as 0.022 and a wear resistance as high as 3.87 × 10-6mm3/Nm. Preparing HNBR-based composite by dual network co-crosslinked is proved being a feasible solution to improve the reliability and service life of water-lubricated bearings.

The development of computational acoustics allows simulation of sound generation and propagation in complex environment. In particular, meshfree methods are widely used to solve acoustics problems through arbitrarily distributed field points and approximation smoothness flexibility. As a Lagrangian meshfree method, smoothed particle hydrodynamics (SPH) method reduce the difficulty in solving problems with deformable boundaries, complex topologies, or multiphase medium. The traditional SPH method has been applied in acoustic simulation. This study presents the corrective smoothed particle method (CSPM), which is a combination of SPH kernel estimate and Taylor series expansion. The CSPM is introduced as a Lagrangian approach to improve accuracy in solving acoustic wave equations in the time domain. Moreover, a boundary treatment technique based on the hybrid meshfree and finite difference time domain (FDTD) method is proposed to represent different acoustic boundaries with particles. To model sound propagation in pipes with different boundaries, soft, rigid, and absorbing boundary conditions are built with this technique. Numerical results show that the CSPM algorithm is consistent and demonstrates convergence with exact solutions. Main computational parameters are discussed, and different boundary conditions are validated to be effective for benchmark problems in computational acoustics.

Climate change has a inevitable impacts on tree radial growth, particularly at mountain timeberlines. To understand climate effects on conifer radial growth in the central Hengduan Mountains and potential impacts of future climate change on conifer forest, we studied growth responses to climate variables in Abies georgei, the major tree species of conifer forest in Hengduan Mountains. We collected tree ring samples from four sites near the timberlines and analyzed the relationship between principle components (PC#1) of four chronologies and climatic variables by using response function analysis (RFA), redundancy analysis (RDA) and moving interval analysis (MIA). A. georgei growth was affected by both temperature (positive effects) and precipitation (negative effects). Specifically, the radial growth of A. georgei was significantly and positively correlated with current July and previous November temperature (detected by both RFA and RDA), while precipitation of current June and September inhibited tree growth (detected by RDA). More rapid warming in recent 20 years (1990–2010) clearly enhanced growth responses to July and November temperature, whereas the relationship was weaken for June and September precipitation according to MIA. Under the climate trend of the study area, if the increasing temperature could offset the negative effects of excessive precipitation, A. georgei radial growth would likely benefit from warming, the dynamics of conifer forest should also consider indirect impacts of climate change.

Preventing the rebound of black and odorous water bodies is critical for improving the ecological environment of water bodies. This study investigated the effect and mechanism of in-situ improvement of sediment microenvironment by nitrate in tailwater of wastewater treatment plants combined with aerobic denitrifying bacteria under low-DO regulation (TailN+CFM+LDO). On the 60th day of remediation, the dissolved oxygen and oxidation-reduction potential in the overlying water increased to 5.6 mg/L and 300 mV, respectively, the acid volatile sulfide in the sediment decreased by 70.4%, and the organic matter in the sediment was reduced by 62.7%, in which the HFOM was degraded from 105 g/kg to 56 g/kg, and the potential risk of water reverting to black and odorous conditions significantly decreased. Amplicon sequencing analysis revealed that the relative abundance of electroactive bacteria Thiobacillus and Pseudomonas with denitrification capacity was found to be significantly higher in the TailN+CFM+LDO group than in the other remediation groups. Functional prediction of 16S sequencing results indicated that both the quantity and activity of critical microbial enzymes involved in nitrification and denitrification processes could enhance in the TailN+CFM+LDO group. These results improved our understanding of the improvement of the sediment microenvironment and could thus facilitate its application.

GRK2 and arrestin3, key players in the functional regulation of G protein-coupled receptors (GPCRs), are ubiquitinated by Mdm2, a nuclear protein. The agonist-induced increase in arrestin3 ubiquitination occurs in the nucleus, underscoring the crucial role of its nuclear translocation in this process. Agonist-induced increase in the ubiquitination of arrestin3 occurs in the nucleus, highlighting the pivotal role of its nuclear translocation in this process. In contrast, GRK2 cannot translocate into the nucleus, thus facilitating the cytosolic translocation of nuclear Mdm2 is required to ubiquitinate GRK2 in the cytosol. Among the cellular components and processes explored, arrestin, Gβγ, clathrin, and receptor phosphorylation were required for the nuclear import of arrestin3, ubiquitination of arrestin3 in the nucleus, nuclear export of Mdm2, and the ubiquitination of GRK2 in the cytosol. In conclusion, our findings demonstrate that agonist-induced ubiquitination of arrestin3 in the nucleus is interconnected to the cytosolic GRK2 ubiquitination.

Road cracks significantly affect the serviceability and safety of roadways, especially in mountainous terrain. Traditional inspection methods, such as manual detection, are excessively time-consuming, labor-intensive, and inefficient. Additionally, multi-function detection vehicles equipped with various sensors are expensive and not suitable for mountainous roads due to poor conditions. To address these challenges, this study proposes a customized Unmanned Aerial Vehicles (UAV) inspection system designed for automatic crack detection. The system focuses on enhancing autonomous capabilities in mountainous terrains by incorporating embedded algorithms for route planning, autonomous navigation, and automatic crack detection. The slide window method is proposed to enhance the autonomous navigation of UAV flights by generating path planning in mountainous roads. This method compensates for GPS/IMU positioning errors, particularly in GPS-denied or GPS-drift scenarios. Moreover, the YOLOv8 algorithm is introduced to conduct autonomous crack detection from UAV imagery in the offboard module. To validate our UAV inspection system's performance, we conducted several experiments to assess its accuracy, robustness, and efficiency. The experimental results demonstrate that our UAS inspection system accurately estimates the flight trajectory along the mountainous road for autonomous navigation. Furthermore, the experimental detection results also demonstrate that the YOLOv8 algorithm achieves higher recognition accuracy compared to the YOLOv5, and YOLOv7-tiny algorithms, exceeding 3.1%,and 6.8% of mAP, respectively. In summary, the UAV inspection system proposed in this study can provide a useful tool and technological guidance for the regular inspection of mountainous roads.

Tunnel-interchange connecting sections pose significant safety challenges on mountainous expressways due to their high incidence of accidents. Improving road safety necessitates a comprehensive understanding of driver behavior in such areas. This study explores the influences of road characteristics, signage information volume, and traffic conditions on drivers' car-following and lane-changing behavior in tunnel-interchange diverging areas. Utilizing driving data from 25 subjects of 72 simulated road models, driving performance is assessed using Friedman rank test and multivariate variance analysis. The results highlight the significant influence of both connection distance and signage information load on driving behavior. In tunnel-interchange scenarios, the reduction of velocity increased by 62.61%, and speed variability surged by 61.11%, indicating potential adverse effects on driving stability due to the environmental transitions. Decreased connection distances are associated with reduced lane-changing durations, larger steering angles, and increased failure rates. Furthermore, every two units increase in signage information leads to a 13.16% rise in maximum deceleration and a 5% increase in time headway. Notably, the signage information volume shows a significant interaction with connection distance (F=1.60, P=0.045) for most car-following indicators. Hence, the study recommends a maximum connection distance of 700 m and signage information not exceeding nine units for optimal safety and stability.

The emergence of drug-resistant mycobacteria has rendered many clinical drugs and regimens ineffective, imposing significant economic and healthcare burden on individuals and society. Repurposing drugs intended for treating other diseases is a time-saving, cost-effective, and efficient approach for identifying excellent anti-mycobacterial candidates or lead compounds. This study is the first to demonstrate that rupatadine (RTD), a drug used to treat allergic rhinitis, possesses excellent activity against mycobacteria without detectable resistance, particularly Mycobacterium tuberculosis and Mycobacterium marinum, with a minimal inhibitory concentration as low as 3.13 µg/mL. Furthermore, RTD exhibited moderate activity against nonreplicating M. tuberculosis with the minimal inhibitory concentrations lower than drugs targeting the cell wall, suggesting that RTD has the great potential to be modified and used for the treatment of nonreplicating M. tuberculosis. Additionally, RTD exhibits partial synergistic effects when combined with clofazimine, pretomanid, and TB47 against M. tuberculosis, providing the theoretical foundation for the development of treatment regimens. Transcriptomic profiling leads us to speculate that eight essential genes may be the targets of RTD or may be closely associated with the mycobacterial resistance to RTD. In summary, RTD may be a promising hit for further anti-mycobacterial drug or regimen optimization, especially in case of nonreplicating mycobacteria.

The rock joint fissure slope in cold regions is prone to deformation and failure problems such as relaxation, tension and collapse under freeze-thaw (F-T) cycles. Based on the ideology of clean production and promoting the structural integrity of geotechnical projects in cold areas, this study designed and prepared aeolian-sand (AS) to replace part of river sand as a filling mortar material by taking advantage of the low cost and easy availability of AS. Investigations were carried out to determine the impact of varying proportions of AS in mortar on the microstructure and shear properties of the mortar-rock interface under F-T cycles. Therefore, F-T cycle testing, nuclear magnetic resonance (NMR) testing and shear testing were carried out on grout with different proportions of AS. The results show that the right proportion of AS replacement could enhance the shear deformation resistance and F-T resistance of the mortar-rock interface, and 30% proportion is the optimal proportion. By increasing of F-T cycles, the three types of specimens showed different degrees of particle spalling, shedding and cracking. The slurry-rock interface layer in the A (0%) group exhibited the most severe F-T deterioration, while the B (15%) group showed a lesser degree, and the C (30%) group performed the best. T2 spectrum curve and total spectrum area change law from the microscopic point of view to verify the 30% AS proportion mortar-rock interface F-T resistance is the strongest, followed by 15% AS proportion mortar, the weakest is ordinary mortar. The degradation of the mortar-rock bond is primarily due to the conversion of solid to liquid phases and the movement of internal water caused by fluctuating temperatures. The extent of F-T deterioration in the slurry-rock interface layer is greatly affected by the varying proportions of AS. The shear strength and shear stiffness of specific proportion of AS decreased with the increase of F-T cycles. For same F-T cycles, the shear strength and shear stiffness of group C (30%) were the highest, followed by group B (15%) and group A (0%). The grout material not only reinforces the F-T joint fissure slope, but also reduces the cost of grout reinforcement and promotes the clean production of geotechnical structures.

【Objectives】To elucidate and enhance the impact of nitrogen fertilizer on capsaicin, thus providing guidance on fertilizer application for the cultivation of high spiciness chilli.【Methods】The experiment was conducted with five nitrogen fertilizer concentrations, N1 (urea 750 kg.hm-2), N2 (urea 562.5 kg.hm-2), N3 (urea 375 kg.hm-2), N4 (urea 187.5 kg.hm-2), and N0 (no nitrogen fertilizer). Nitrogen treatment was applied to two varieties with different spiciness from seedling stage, and the fruit was sampled at three fruit developmental periods, and the contents of capsaicin, capsaicin precursors, capsaicin competitive substances, as well as capsaicin related enzyme activities and gene expression were analyzed.【Results】When applying N2 and N3, both types of peppers exhibited higher fruit length, fruit width, and fruit weight, which favored yield increase. Specifically, N2 resulted in varied increases in total phenol, flavonoid, and tannin contents of the two varieties. Moreover, placenta weight and PAL enzyme activity of capsaicin synthase significantly increased, while capsaicin degrading enzyme activities of POD and PPO decreased notably. Additionally, the expression of capsaicin synthetic genes such as PAL, AT3, 4CL, C4H, COMT, PAMT, and HCT was up-regulated in N2-treated fruits, leading to a significantly higher capsaicin content compared to the other four treatments. Further reduction of nitrogen application to N3 and N4 resulted in decreased precursor substance total phenol content and PAL activity, increased competitive substance flavonoid, lignin, POD and PPO enzyme activities, at the same time, the expression levels of capsaicinoid synthetic genes were down-regulated in N3, N4 treatments, which lead to an reduction in total capsaicinoid content. During fruit development, the capsaicinoid content showed a trend of 35 d > 50 d > 20 d for both varieties. Additionally, the contents of total capsaicinoid, total phenol, flavonoid, and lignin, as well as PAL enzyme activity and the expression of PAL, AT3, 4CL, C4H, COMT, PAMT, and HCT of the fruit, exhibited characteristics of lower layer > middle layer > upper layer. Furthermore, the activities of capsaicinoid degrading enzymes POD and PPO gradually increased from bottom to top.【Conclusions】The N2 (562.5 kg.hm-2) treatment resulted increases of placenta mass, maximum precursor substance total phenol content and synthase enzyme activity, and decreases of competing substances and degradative enzyme activity, resulting in more substances being available for capsaicin synthesis. Combined with the higher fruit weight in the N2 treatment, N2 was therefore considered to be a suitable nitrogen fertilizer dosage for high spiciness chilli cultivation.

Animal personalities play a crucial role in invasion dynamics during alien species invasions. The behavioral strategies adopted by native species varied among personalities when facing an invasion by alien species, just as the invasive species exhibited variations in behavior strategies across different personalities during the invasion process. However, the effects of personality interactions between native species and invasive species on behavior and growth are rarely illustrated. We used the globally invasive freshwater turtle Trachemys scripta elegans and the native freshwater turtle Mauremys reevesii to investigate how the personality combinations of native and invasive turtles would impact the foraging strategy and growth of both species. We found that M. reevesii exhibited bolder and more exploratory personalities than T. scripta elegans. The foraging strategy of M. reevesii was mainly affected by the personality of T. scripta elegans, while the foraging strategy of T. scripta elegans was influenced by both their own personality and M. reevesii's personality. In addition, we did not found that the personality combination would affect the growth of either T. scripta elegans or M. reevesii. Difference in foraging strategy may be due to the competitive advantage of invasive species and variations in the exploration-exploitation foraging strategy among different personalities. Overall, our results reveal the mechanisms of personality interaction effects on the foraging behavior of both native and invasive species during alien species invasion and provide empirical evidence to help understand the effects of personality in invasion dynamics.

Track fasteners play a pivotal role in infrastructure inspection for high-speed rail. Yet, images taken by drones often capture shadows cast by electrical towers flanking the high-speed rail tracks. These shadows can hinder the visibility of the track fasteners, thereby impacting detection efficiency and accuracy considerably. The present paper introduces an end-to-end shadow removal algorithm, rooted in generative adversarial network training. The comprehensive network framework is segmented into three sub-networks: pseudo-mask generation, shadow removal, and result refinement. We have integrated a Fourier convolutional residual module to bolster the feature extraction capability of the generator network. This integration ensures the network retains a global receptive field, even in its more superficial layers. By employing an overall weighted loss function, we enhance the quality of the images produced without shadows. Further, a perceptual loss function has been incorporated to retain the structural information of objects, setting the stage for subsequent defect detection. Our results highlight that Pse-ShadowNet adeptly eradicates fastener shadows while maintaining vital visual features, including object position, structure, texture, edges, and other key visual elements. Consequently, the reconstructed images are detailed and showcase superior image quality.

in order to enhance the separation performance and to reduce the heat loss of the transmembrane for membrane distillation, the thermal efficiency and hydrophobicity of the membrane distillation should be simultaneously enhanced. In this work, a PVDF/PET hydrophobic/hydrophilic membrane is prepared by non-solvent phase inducing method. Nanosized silica aerogel (SiAG) with high porosity is added to the composite membranes. The modifying effects and operating conditions on permeate flux and thermal efficiency in direct contact membrane distillation (DCMD) are investigated. Furthermore, the latent heat of vaporization and the heat transfer across the membranes are compared for SiAG addition, which indicates that the composite PVDF@SiAG/PET membranes display a great potential for distillation-separation application with high heat efficiency.

At present, the drilling rig for deep seabed shallow strata is widely used in the exploration of ocean cobalt-rich crust resources and other fields, which not only can obtain solid core samples at a specific station, but the operation process is relatively safe. This paper mainly presents the structure and mechanism of mobile drilling rig in acquiring the seafloor cores (up to 1.5 m long). Based on the function of the AMESim software, the hydraulic propulsion system model of mobile drilling rig is established, which is the basis and core part of the mobile drilling rig. Moreover, the control methods of closed-loop and PID are respectively used to control the hydraulic propulsion system for simulation analysis. Through the comparison of simulation results, it is found that the PID control method is more convincing in verifying the design rationality of hydraulic propulsion system. In the simulation of the PID-controlled hydraulic propulsion system, the co-simulation technology of AMESim and Matlab/Simulink not only establishes the hydraulic model and control model, but also determines the relevant simulation parameters, which is helpful to improve the system simulation efficiency. In its verification deployment in the South China Sea, the mobile drilling rig has been operated for many times at different depths, and some cores have been successfully obtained. Furthermore, the mobile drilling rig has been used during the 55th Voyage of China Oceanic Scientific Expedition supported by China Ocean Mineral Resources R&D Association. Several sites were explored and a large number of cobalt-rich crust cores were obtained. The powerful theory and sea trails are provided to support for the further research on survey of the abyssal resource.

In this note, we provide some effective treatments of a general linear model with adding-up restrictions via algebraic operations of given vectors and matrices in the model, including analytic expressions of the well-known ordinary least-squares estimator (OLSE) and the best linear unbiased estimator (BLUE) of the unknown parameters in the model.

This note shows that the well-known reverse order law $(AB)^{\dag} = B^{\dag}A^{\dag}$ for the Moore--Penrose inverse of matrix product is equivalent to many other equalities for that are composed of multiple products $(AB)^{\dag}$ and $B^{\dag}A^{\dag}$ by means of the definition of the Moore--Penrose inverse and orthogonal projector theory.

The black hole information paradox is one of the most puzzling paradoxes in physics. Black holes trap everything that falls into them, while their mass may leak away through purely thermal Hawking radiation. When a black hole vanishes, all the information locked inside, if any, is just lost, thus challenging the principles of quantum mechanics. However, some information does have a way to escape from inside the black hole, that is, through gravitational waves. Here, a concise extension of this notion is introduced. When a black hole swallows something, whether it is a smaller black hole or an atom, the system emits gravitational waves carrying the information about the “food”. Although most of the signals are too weak to be detected, the information encoded within them will persist in the universe. This speculation provides an explanation for a large part, if not all, of the supposed “information loss” in black holes, and thus reconciles the predictions of general relativity and quantum mechanics.

One of the typical forms of linear matrix expressions (linear matrix-valued functions) is given by $A + B_1X_1C_1 + \cdots + B_kX_kC_k$, where $X_1, \ldots, X_k$ are independent variable matrices of appropriate sizes, which include almost all matrices with unknown entries as its special cases. The domain of the matrix expression is defined to be all possible values of the matrix expressions with respect to $X_1, \ldots, X_k$. I this article, we approach some problems on the relationships between the domains of two linear matrix expressions by means of the block matrix method (BMM), the matrix rank method (MRM), and the matrix equation method (MEM). As application, we discuss some topics on the relationships among general solutions of some linear matrix equations and their reduced equations.

Land surface temperature (LST) is a critical parameter for the dynamic simulation of land surface processes and for analyzing variations on regional or global scales. Obtaining LST with high spatiotemporal resolution is a subject of intensive and ongoing research. This study proposes a pixel-wise temporal alignment iterative linear regression model for downscaling based on MODIS LST products. This approach allows us to address the problem of high temporal resolution but low spatial resolution of the ERA5 reanalysis LST product, while remaining immune to pixel loss caused by clouds. The hourly ERA5 LST of the study area for 2012–2021 was downscaled to 1000 m resolution, and its accuracy was verified by comparison with measured data from meteorological stations. The downscaled LST offers intricate details and is faithful to the LST characteristics of distinct land-cover categories. In comparison with other downscaling techniques, the proposed technique is more stable and preserves the spatial distribution of ERA5 LST with minimal missing pixels. The pixel-wise average R-squared and mean absolute error for MODIS view times are 0.87 and 2.7 K, respectively, for cloud-free conditions at a 1000 m scale. Accuracy verification using data from meteorological stations indicates that the overall error is lower during cloudless periods rather than during overcast periods, during the night rather than during the day, and at MODIS view times rather than at non-view times. The maximum and minimum mean errors are 0.13 K for cloud-free periods and −0.98 K for cloudy periods, indicating a slight underestimation and overestimation, respectively. Conversely, the maximum and minimum mean absolute errors are 2.01 K for the daytime and 0.85 K for the nighttime. Therefore, the model ensures higher accuracy during cloudy periods with only clear sky LST as input data, making it suitable for long-term, all-weather ERA5 LST downscaling.

In order to correct attenuated millimeter-wavelength (Ka-band) radar data and address the problem of instability, an attenuation correction methodology (attenuation correction with variation trend constraint; VTC) was developed. Using synchronous observation conditions and multi-band radars, the VTC method adopts the variation trends of reflectivity in X-band radar data captured with wavelet transform as a constraint to adjust reflectivity factors of millimeter-wavelength radar. The correction was evaluated by comparing reflectivities obtained by millimeter-wavelength cloud radar and X-band weather radar. Experiments showed that attenuation was a major contributory factor in the different reflectivities of the two radars when relatively intense echoes exist, and the attenuation correction developed in this study significantly improved data quality for millimeter-wavelength radar. Reflectivity differences between the two radars were reduced and reflectivity correlations were enhanced. Errors caused by attenuation were eliminated, while variation details in the reflectivity factors were retained. The VTC method is superior to the bin-by-bin method in terms of correction amplitude and can be used for attenuation correction of shorter wavelength radar assisted by longer wavelength radar data.

In (Semigroup Forum 77: 325-338, 2008) Mahmoudi M. and Renshaw J. solved a study that covers of cyclic $S$-acts over monoids. This article is an attempt to initiate the covers of finitely generated $S$-acts. We give a necessary and sufficient condition for a monoid to have the properties that $n$-generated $S$-acts have strongly flat covers, Condition $(P)$ covers and projective covers. The main conclusions extend some known results. We show also that Condition $(P)$ covers of finitely generated $S$-acts are not unique, unlike the situation for strongly flat covers. Additionally, we demonstrate that the property of Enochs' $\mathcal{X}$-precover of $S$-act $A$, where $\mathcal{X}$ denotes a class of $S$-acts that are closed under isomorphisms.

As the largest accretionary orogen in the world, the Central Asian Orogenic Belt (CAOB) has continuous juvenile crustal growth in the Phanerozoic. The northern margin of the North China Craton(NCC) and its adjacent area is the eastern segment of the CAOB, and is a key area to study the geological evolution of Paleo-Asian Ocean (PAO). In the Permian, the west of the northern margin of NCC belongs to a post-collision extensional environment, and the east belongs to a subduction stage. But, As a connecting area, the Permian evolution of PAO in the middle of northern margin of NCC has not been systematically studied. In order to fill the blank and understand the temporal and spatial continuous evolution process of PAO, this paper focused on the Permian granitic rocks in the Chifeng area, zircon U-Pb dating and the geochemical analysis of the whole rock main and trace elements were conducted in order to build a granite chronological framework, discuss the genesis and tectonic background of the granite rocks as well as the magma-tectonic evolution history in the Chifeng area. Zircon U-Pb dating results of 8 samples are 269±1 Ma, 268±3 Ma, 260±4 Ma, 260±1 Ma, 260±1 Ma, 255±2 Ma, 254±2 Ma, 256±1Ma, which showed that the Permian granitic rocks had undergone three stages of emplacement: (1) The monzogranite and syenite (294-284 Ma); (2) The monzogranite (269-260Ma) and (3) The monzogranite and syenite (256-254Ma). The Middle Permian magmatism (269-260Ma) was represented by the monzogranite assemblages with different grain sizes. The geochemical characteristics showed that they were high-potassium calc-alkaline-potassium dossonite series of granites formed in compressional environment, indicating there was a collision between the Xing’an-Mongolian Orogenic Belt (XMOB) and the North China Craton (NCC). During the Late Permian-Early Triassic (256-248Ma), the granites in the Chifeng area are dominated by the A-type and I-type granites of high-potassium calc-alkaline series formed under an extensional environments, which constituted typical "bimodal" rock assemblage combined with the coeval basic rocks, suggesting the study area was in an extensional environment where the subducting slab is fragmented during the collision between the XMOB and the NCC. According to emplacement time and occurrence location, the plutons are interpreted to have been generated by the subduction-collision of the Paleo-Asian oceanic crust beneath the NCC. This study provides strong evidence for Permian tectonic evolution and the characterization of the eventual closure of the Paleo-Asian Ocean in the Chifeng City at the northern margin of the NCC.

The process of shock wave focusing can make the strength of shock waves be continuously accumulated and turned into detonation wave in Pulse Detonation Engine (PDE). However, its effective application needs the inlet jets be in high temperature and velocity, which is difficult to be satisfied under certain conditions. Therefore, in this paper, metal magnesium assisted detonation initiation is proposed and the effect of magnesium particle addition on the shock wave focusing process in a kerosene-fueled PDE with cavity configuration is investigated through numerical simulation. The result showed that when the temperature of the premixed fuel/air jets injected in opposite direction was set as 650 K, the collision of leading shock waves on the central axis was the main source of energy deposition and the shock wave focusing could make the detonation be initiated in the cavity. When the temperature of jets is reduced to 550 K, fuel ignition and detonation could not be achieved through shock wave focusing. Then adding metal magnesium particles into the combustor made the energy deposition be enhanced and the detonation be induced. The diffusion of metal particles can significantly change the structure, motion, merging and dissipation of vortices in the flow field. Generally, the shock wave focusing process is basically not affected with metal particles injection. Therefore, this method can be successfully employed for detonation initiation in the cavity when the fuel/air premixed jet temperature is not high for PDE.

CO₂ enhanced oil recovery (EOR) has been proven its capability to explore the unconventional tight oil reservoirs and potential for geological carbon storage. Meanwhile, the extremely low permeability pores exaggerate the difficulty CO₂ EOR and geological storage processing in the actual field. This paper initiates the ultrasonic-assisted approach to facilitate the oil-gas miscibility development and finally contribute to unlock more tight oils. First, the physical properties of crude oil with and without ultrasonic treatments were experimentally analysed through gas chromatography (GC), Fourier-transform infrared spectroscopy (FTIR) and viscometer. Second, the oil-gas minimum miscibility pressures (MMPs) were measured from the slim-tube test and the miscibility developments with and without ultrasonic treatments were interpreted from the mixing-cell method. Third, the nuclear-magnetic resonance (NMR) assisted coreflood tests were conducted to physically model the recovery process in porous media and directly obtain the recovery factor. Basically, the ultrasonic treatment (40KHz and 200W for 8 hours) was found to substantially change the oil properties, with viscosity (at 60°C) reduced from 4.1 to 2.8mPa·s, contents of resin and asphaltene decreased from 27.94% and 6.03% to 14.2% and 3.79%, respectively. The FTIR spectrum shows the unsaturated C-H bond, C-O bond and C≡C bond in macromolecules were broken from ultrasonic, which caused the macromolecules (e.g., resin and asphaltenes) to be decomposed into smaller carbon-number molecules. Accordingly, the MMP was determined to be reduced from 15.8 to 14.9MPa from the slim-tube test and the oil recovery factor increased by over 10%. This study reveals the mechanisms of ultrasonic-assisted CO₂ miscible EOR in producing tight oils.

Promoting green development has become an important way to optimize the ecological and economic structure and promote sustainable development. The Yangtze River Economic Belt is an important economic corridor in China, and it remains to be examined whether the implementation of environmental regulations has enhanced the green total factor productivity (GTFP) of cities. This paper calculates the green total factor productivity of 107 cities within the Yangtze River Economic Belt by using the super-efficient SBM model and the GML index with Chinese city panel data from 2007-2019 and measures the intensity of environmental regulations through textual analysis. The bidirectional fixed-effects model constructed in this paper suggests an inverted U-shaped relationship between environmental regulation and GTFP, which is confirmed by a series of robustness tests. Green technology innovation and advanced industrial structure play a mechanism role in this. In regions with lower levels of green technology and industrial structure, the inverted U-shaped relationship between environmental regulation and green total factor productivity is more significant. In addition, the phenomenon of GTFP rising and then falling because of environmental regulation is more obvious in cities in the middle and upper reaches of the Yangtze River and outside the urban agglomerations. Therefore, when formulating environmental regulation policies, it is necessary to balance the relationship between economic development and environmental protection and harmonize the environment and economic development of the entire Yangtze River Basin.

With the increasing concern of environment, the energy-efficiency scheduling of manufacturing industry is becoming urgent and popular. In turning processes, both spindle speed and processing time can affect the final energy consumption and thus the spindle speed and scheduling scheme need to be optimized simultaneously. Since the turning workshop can be regarded as the flexible flow shop, this paper formulates a mixed integer linear programming model for energy-efficient scheduling of flexible flow shop. Accordingly, a new decoding method is developed by considering of the optimization of spindle speed and scheduling scheme simultaneously, and an estimation of distribution algorithm adopting the new decoding method is proposed to solve large-size problems. The parameters of this algorithm are determined by statistical technique with a simplified practical case. In order to validate the proposed method, a case from practical factories is studied, in which the makespan can be shortened by 25.22%, and the consumed energy can be saved by 5.48%. These results demonstrate the effectiveness of the proposed mathematical model and algorithm.

This paper aims to address the exponential stability and stabilization problems for a class of delayed nonlinear Markov jump systems under randomly occurring Denial-of-Service (DoS) attack and packet loss. Firstly, the stochastic characteristics of DoS attack and packet loss are depicted by the attack success rate and packet loss rate. Secondly, a Period Observation Window (POW) method and a hybrid-input strategy are proposed to compensate for the impact of DoS attack and packet loss on the system. Thirdly, A Dynamic Event-triggered Mechanism (DETM) is introduced to save more network resources and ensure the security and reliability of systems. Then, by constructing a general common Lyapunov functional and combining with the DETM and other inequality analysis techniques, the less conservative stability and stabilization criteria for the underlying systems are derived. In the end, the effectiveness of our result is verified through a numerical example.

We describe a selective and sensitive fluorescence platform for the detection of trinitrophenol (TNP) based on competitive host–guest recognition between pyridine-functionalized pillar[6]arene (PCP6) and probe (acridine orange, AO) that used PCP6-functionalized reduced graphene (PCP6-rGO) as the receptor. TNP is an electron-deficient and negative molecule which is captured by PCP6 via electrostatic interactions and π-π interactions. Therefore, a selective and sensitive fluorescence sensor for TNP detection is developed. It has a low detection limit of 0.0035 μM (S/N=3) and a wider linear response of 0.01−5.0 and 5.0−125.0 for TNP. The sensing platform is also used to test TNP in two water and soil samples with satisfying results. This suggests that this approach has potential applications for the determination of TNP.