Keywords: mHealth; peritoneal dialysis; functionality; usability

Women are at higher risk of cognitive impairment and Alzheimer’s disease (AD) after menopause when the estrous cycle becomes irregular and begins to taper off. Numerous studies have shown that estrogen deficiency, especially estradiol (E2), has been shown to play a key role in this phenomenon. Recently, a novel polymeric drug, hyaluronic acid-17β-Estradiol conjugate (HA-E2), has been developed which has the ability to cross the blood-brain barrier (BBB), facilitate a longer E2 release profile and lower risk of estrogen supplement related side effects. In this study, we used an ovariohysterectomy (OHE) rat model of postmenopausal cognitive deficits and explore whether HA-E2 treatment can improve the cholinergic septo-hippocampal innervation system, synaptic transmission in the hippocampal pyramidal neuron and cognitive impairment. Our results show that OHE rats after HA-E2 administration have increased expression of choline acetyltransferase (ChAT) in the medial septal nucleus (MS nucleus) and the hippocampus, increased spine density in hippocampal pyramidal neurons, and improved spatial learning and memory. Therefore, HA-E2 has great potential as a new novel class of drugs for estrogen-deficiency-induced cognitive impairment and AD.

Regulatory T cells are key immune cells to initiate tolerable immune responses. TGFβ is the key cytokine of regulatory T cells. TGFβ is also the master cytokine to stimulate tissue fibrosis. Systemic sclerosis is an autoimmune disease related to overt organ fibrosis. Thus, systemic sclerosis is a disease related to regulatory T cell over-representation. Besides, many end stage organ failures including heart failure, liver cirrhosis, uremia, and pulmonary fibrosis also related to tissue fibrosis. Thus, TGFβ producing regulatory T cells are also involved in the pathogenesis of these end stage organ failure. Once we know the significance of TGFβ and it induced tolerable immune reactions in the pathophysiology of end organ failure, we can develop better prevention or therapeutic strategies to combat these detrimental disorders.

The mechanism of immune activation and de-activation is very important. Host should trigger effective immunity against pathogen infection. And, host cannot trigger immunity against self-antigens that will lead to detrimental autoimmune disorders. Spleen and liver have opposite roles in mediating immune responses. Spleen is the organ involving in immune activation, and liver is the organ involving in immune de-activation. Sympathetic nerve system and parasympathetic nerve system have opposite roles in mediating immune responses. Sympathetic nerve system is involving in pro-inflammatory, and parasympathetic nerve system is involving in anti-inflammatory. ACTH and glucocorticosteroid have opposite roles in mediating immune responses. ACTH is involving in activating adaptive immunity with inhibiting innate immunity, and glucocorticosteroid is involving in activating innate immunity with inhibiting adaptive immunity. The molecular chaperons, heat shock proteins, which are induced by fever, have the vital roles in immune activation. On the contrary, IgD B cells and gamma-delta T cells are causing immune de-activation via the mechanism of clonal anergy. These mechanism can help us the know the work of immunological pathways better for better control of infectious diseases and autoimmune disorders.

Systemic lupus erythematosus (SLE) is a prevalent autoimmune condition, yet its alignment with a specific host immunological pathway remains unclear. The THαβ host immunological pathway, recognized for its defense against viruses and prions, has recently emerged as a response to DNA, RNA, and protein pathogens. SLE patients often produce anti-double strand DNA antibodies and anti-nuclear antibodies, suggesting a potential association with the THαβ host immune reaction. Throughout the course of SLE, elevated levels of type 1 interferons, type 3 interferons, interleukin-10, IgG1, and IgA1 are commonly observed. These cytokines and antibody isotypes are indicative of the THαβ host immunological pathway. Similarly, Myasthenia gravis, Grave’s disease, Graft versus host disease, autoimmune hemolytic anemia, immune thrombocytopenia, dermatomyositis, and Sjogren’s syndrome are also linked to THαβ-related type 2 hypersensitivities. Considering the potential association of these diseases with dysregulated THαβ immune responses, therapeutic strategies such as anti-interleukin-10 or anti-interferons α/β could be explored to manage these disorders effectively.

Sustainable urban design or planning is not a LEGO-like assembly of prefabricated elements, but an embryo-like growth with persistent differentiation and adaptation towards a coherent whole. The coherent whole has a striking character – called living structure – that consists of far more small substructures than large ones. To detect the living structure, natural streets or axial lines have been previously adopted to be topologically represent an urban environment as a coherent whole. This paper develops a new approach to detecting the underlying living structure of urban environments. The approach takes an urban environment as a whole and recursively decomposes it into meaningful subwholes at different levels of hierarchy or scale ranging from the largest to the smallest. We compared the new approach to natural street and axial line approaches and demonstrated, through four case studies, that the new approach is better and more powerful. Based on the study, we further discuss how the new approach can be used not only for understanding, but also for effectively designing or planning the living structure of an urban environment to be more living or more livable.

Gesture recognition technology has been quickly developed in the field of human-computer interaction. The multiple-input multiple-output (MIMO) radar has been widely adopted in gesture recognition because of its notable spatial resolution. In this work, a highly accurate MIMO radar-based hand gesture recognition algorithm with very low complexity is proposed. To make the proposed system applicable in the industry and work well even when the size of the training data is limited, we applied several low-complexity adaptive signal processing methods to extract features and reduce the noise effect. First, spectrum analysis is applied to range-Doppler maps (RDMs) and a cell-averaging constant false alarm rate (CA-CFAR) with mirror filters is applied to improve the robustness to noise. Afterward, the features related to the distance, speed, direction, and the elevation angle of the moving object are determined by the proposed adaptive signal analysis techniques and the random forest is applied for classification. The proposed system has the capability to precisely distinguish and identify eight motions, including waving, moving to the left or right, patting, pushing, pulling, and rotating clockwise or anticlockwise, with an accuracy of 95%. Experiments demonstrate the capability of the proposed hand gesture recognition system to classify different movements precisely.

Light sources tend to affect images captured in any automatic optical inspection (AOI) system. In this study, the effectiveness of metal-halide lamps, quartz-halogen lamps, and LEDs as the light sources in AOI systems for the detection of the 3rd and 4th layers electrodes of thin-film-transistor liquid crystal displays (TFT-LCDs) is examined experimentally. The results show that the performance of LEDs is generally comparable or better than that of metal-halide and quartz-halogen lamps. The best optical performance is by the blue LED due to its spectrum compatibility with the time-delay-integration charged-coupled device (TDI CCD) sensor and its better spatial resolution. The images revealed by the blue LED are sharper and more distinctive. Since current LEDs are more energy efficient and environmentally friendly, using LEDs as the light source for AOI is very beneficial. As the blue LED performs the best, it should be adopted for AOI using TDI CCD sensors.

Among colours, the green has the most sensitivity in human vision so that green defects on displays can be effortlessly perceived by a photopic eye with the most intensity in the wavelength 555 nm of the spectrum. With the market moving forward to high resolution, displays can have resolutions of 10 million pixels. Therefore, the task detects the appearance the panel using ultra-high resolutions in TFT-LCD. The machine vision associated with reflective chromaticity spectrometer quantises the defects are explored, such as blackening and whitening. The result shows the significant phenomena to recognize the non-uniformity film-related chromatic tendency. In contrast, the quantitative assessment illuminates that the chromaticity CIE xyY at 0.001 is a just noticeable difference (JND) and detects even more sensitivity. Moreover, an optical device associated with a 198 Hg discharge lamp calibrates the spectrometer accuracy.

The teaching and learning environment have changed significantly over the last decade with the integration of an increasing amount of information and communication technologies, especially in distance education due to global pandemics, total lockdowns, isolation, and quarantine periods. The number of numerous virtual and non-virtual tools involved in educational processes is growing day by day. In terms of technological innovations used in learning environments, many researchers and educators are trying their best to bring more creative ideas into the technology- based learning environments. Although higher educational institutions have greatly benefited from the growing number of hardware and software resources in the educational process, they have also faced some setbacks that have harmed the learning processes. These technologies have in turn complicated some of the processes in the learning atmosphere. Therefore, we take Spanish teaching course as an example to present the challenging smarter teaching and learning systems that higher educational institutions face today.

Protrusive defects on the color filter of thin-film transistor (TFT) liquid crystal displays (LCDs) frequently damage the valuable photomask. An fast method using side-view illuminations associated with digital charge-couple devices (CCDs) to detect the protrusive defect in the four substrates, which are the black matrix (BM), red, green, and blue. Between the photomask and substrate, the depth of field (DOF) is normally 300 μm for the proximity-type aligner; we select the four substrates to evaluate the detectability in the task. The experiment is capable of detecting measurements of 300 μm and even lower than 100 μm can be assessed successfully. The maximum error of the measurement is within 6% among the four samples. Furthermore, the uncertainty analysis of three standard deviations is conducted. Thus, the method is cost-effective to prevent damage for valuable photomasks in the flat panel display industry.

It was believed that the construction of large dams in the upper tributary basin of the Chao Phraya River (CPR) has caused sediment load reduction in the CPR system by 75–85%. Based on historical and observed river flow and sediment data measured during 1922–2019, we investigated the effects of three large dams, the Sirikit, Naresuan, and Khwae Noi dams, on river runoff and sediment loads supplied to the CPR using Mann-Kendall (MK) test and the double mass curve (DMC). Results from this study revealed that the Nan River contributed approximately 40% and 57% of the runoff and total sediment load (TSL) to the CPR, respectively. The water regulation by the Naresuan diversion dam has mainly caused the reduction on annual runoff and TSL downstream of each dam. The results from this study also reveal that the sediment load observed at the headwater (C.2) of the CPR still increased after the construction of the Sirikit dam due to the expansion of irrigation areas downstream of the dam and the channel improvement in the lower reach of Nan River. After the three major dams were operated, the sediment load at C.2 reduced by 31% compared that discharging during the pre-construction period.

Neuronal cell death in the central nervous system has always been a challenging process to decipher. In physiological condition, neuronal cell death is restricted in the adult brain even as people ages. However, in pathological conditions of various neurodegenerative diseases, the cell death and shrinkage of a specific brain region represent a fundamental pathological feature across different neurodegenerative diseases. In this review, we will briefly go through the general pathways of cell death and describe the evidence of the cell deaths in the context of common neurodegenerative diseases individually, discussing our current understandings of cell death in connecting with the renowned pathogenic proteins, including tau, amyloid-beta, alpha-synuclein, huntingtin, and TDP-43.

This study proposes an image recognition method to assist swine farm managers in collecting health data related to pig feeding and excretion. Analyzing the correlation between sow health data and indoor air quality in the pigsties revealed significant influences of air quality indicators on sow health. Increased levels of TVOC, CO2, and temperature were found to negatively affect feeding health, while increased temperature, humidity, and PM10 were found to negatively impact excretion health. These findings provide a basis for evaluating variables when constructing future sow disease prediction models. Analyzing the correlation between pig health status and air quality can help swine farm managers improve sow production environments, reduce disease risks, enhance production efficiency, and provide valuable insights for future research on disease prediction models.

Endoplasmic reticulum (ER) stress triggers a series of signaling and transcriptional events termed the unfolded protein response (UPR). Severe ER stress is associated with the development of fibrosis in different organs including lung, liver, kidney, heart, and intestine. ER stress is an essential response of epithelial and immune cells in the pathogenesis of inflammatory bowel disease (IBD) including Crohn’s disease. Intestinal epithelial cells are susceptible to ER stress-mediated damage due to secretion of a large amount of proteins that are involved in mucosal defense. In other cells, ER stress is linked to myofibroblast activation, extracellular matrix production, macrophage polarization, and immune cell differentiation. This review focuses on the role of UPR in the pathogenesis in IBD from an immunologic perspective. The roles of macrophage and mesenchymal cells in the UPR from in vitro and in vivo animal models are discussed. The links between ER stress and other signaling pathways such as senescence and autophagy are introduced. Recent advances in the understanding of the epigenetic regulation of UPR signaling are also updated here. The future directions of development of the UPR research and therapeutic strategies to manipulate ER stress levels are also reviewed.

Performance of the overhead squat may affect golf swing mechanics associated with golf-related low back pain. This study investigates the difference in lumbar kinematics and joint loads during the golf downswing between golfers with different overhead squat abilities. Based on the per-formance of the overhead squat test, 21 golfers aged 18 to 30 years were divided into the highest-scoring group (HS, N=10, 1.61 ± 0.05 cm, and 68.06 ± 13.67 kg) and lowest-scoring group (LS, N=11, 1.68 ± 0.10 cm, and 75.00 ± 14.37 kg). Data collection used a motion analysis system, two force plates, and TrackMan. OpenSim software was used to simulate the joint loads for each lum-bar joint. An independent t-test was used for statistical analysis. Compared to golfers demonstrat-ing limitations in the overhead squat test, golfers with better performance in the overhead squat test demonstrated significantly greater angular extension displacement on the sagittal plane, smaller lumbar extension angular velocity, and smaller L4-S1 joint shear force. Consequently, the overhead squat test is found to be a useful index to reflect lumbar kinematics and joint loading patterns during the downswing, and provides a good training guide reference for reducing the risk of a golf-related low back injury

(1) Background: This study aimed to explore how prolonged mask use during the COVID-19 pandemic affected appearance anxiety; (2) Methods: It implemented a quantitative–qualitative mixed-research approach based on a convenience sample of young people in Taiwan; (3) Results: A total of 1,118 participants completed the online questionnaire. A total of 49 participants reached the 55-point threshold of Appearance Anxiety Scale. Higher score of appearance anxiety was correlated to higher state anxiety statistically (r = 0.4, p < 0.001). Ten participants were interviewed and qualitative content analysis revealed 5 main themes and 16 subthemes. Three of the main themes were related to the positive effects of wearing masks for pandemic prevention and reducing appearance anxiety: “Wearing masks indicates compliance with the epidemic prevention requirement,” “Wearing masks functions as protection against lack of confidence in appearance,” and “Wearing masks helps mitigate the fear of being judged by others.” The remaining two “Wearing masks shifts attention from appearance to figure” and “Prolonged mask wearing exacerbates the anxiety about taking it off” were related to the impacts of long-term mask use; (4) Conclusions: results enhance understanding of negative emotional experiences and anxiety related to physical appearance.

With the development of sensor and communication technologies, Internet of Things (IoT) subsystem is gradually becoming a crucial part in vehicles. It can effectively enhance functionalities of vehicles. However, new attack types are also emerged. For example, a driver with the smart key in the pocket can push the start button to start a car when. At the same time, security issues in the push-to-start scenario are alerted, such as smart key forgery. In this paper, we propose a vehicle Passive Entry Passive Start (PEPS) system that uses deep learning algorithms to recognize the driver by the Electrocardiogram (ECG) signals measured by his or her smart watch. ECG signals are used for verification. Smart watches, as a new smart key of PEPS system, can replace traditional smart keys to improve security. Experiment results show that Long Short-Term Memory (LSTM) models have achieved the best accuracy score for identity recognition (91%) when single ECG cycle is used. However, it takes at least 30 minutes for training. The training time of Auto Encoder successfully reduces to 5 minutes. When 15 continuous ECG cycles are used, it can achieve 100% identity accuracy.

Concrete cracks and local damage can affect the bond performance between concrete and steel bars, thereby reducing the durability of reinforced concrete structures. Compared with general concrete crack repair methods, biomineralization repair not only has effective bonding capabilities but is also particularly environmentally friendly. In view of this, this study aimed to apply biomineralization technology to repair damaged fiber-reinforced lightweight aggregate concrete (LWAC). Two groups of LWAC specimens were prepared. The control group used lightweight aggregates (LWAs) without bacterial spores and nutrient sources, and the experimental group used LWAs containing bacterial spores and nutrient sources. These specimens were first subjected to compression tests and pull-out tests, respectively, and thus were damaged. After the damaged specimen healed itself in different ways for 28 days, secondary compression and pull-out tests were conducted. The self-healing method of the control group involved placing the specimens in an incubator. The experimental group was further divided into experimental group I and experimental group II. The self-healing method of experimental group I was the same as that of the control group. The self-healing method of experimental group II involved soaking the specimen in a mixed solution of urea and calcium acetate for two days, and then taking it out and placing it in an incubator for two days, with a cycle of four days. The test results showed that, compared with the control group specimens, the relative bond strength ratio of the experimental group II specimens increased by 17.9%. Moreover, the EDS and XRD analysis results confirmed that the precipitate formed at the crack was calcium carbonate, which improved the compressive strength and bond strength after self-healing. This indicates that the biomineralization maintenance method used in experimental group II is more effective.

This study explores the public library service evaluation domain through user-generated content on Google Maps, highlighting digital feedback's significant yet underexplored potential in understanding public library patronage across Taiwan's six major cities. Utilizing a mixed-methods research design, this study integrates Google Maps review content analysis with Social Network Analysis to delineate public perceptions and identify areas for service enhancement in public libraries. It innovatively leverages personal experiences extracted from over 60,000 Google Maps reviews to evaluate public library services in cities such as Taipei, New Taipei, Taoyuan, Taichung, Tainan, and Kaohsiung. The research taps into the National Library of Taiwan's National Library Statistics System to provide a robust analysis of library performance and user satisfaction, offering a novel perspective by emphasizing user-centric feedback from Google Maps as a primary data source. This approach provides quantitative data on library usage and geographic distribution and enriches our understanding of the qualitative experiences of library users. In analyzing the keywords from Google Maps reviews of public libraries, we categorize and interpret these under the three core LibQUAL+ dimensions—Affect of Service, Information Control, and Library as Place. The findings expose variances in perceived service quality among the cities, with Kaohsiung and Taichung receiving the highest accolades for service satisfaction. Simultaneously, the study identifies potential areas for improvement, particularly in cities with lower satisfaction ratings like Taipei. This personalized feedback illustrates the intimate relationship between public libraries and their communities, offering invaluable insights for policymakers and library management to enhance service delivery and user experience.

With worsening environmental degradation and increasing international demand for human health, plant cell based technology will be more important. The aim of this review is to give an overview regarding key points of current progress and development trend of nature medical and edible plants from the framework of whole plant cell engineering including cell cultures, cell fusion and cell splitting derived biotechnology. Here we sum up three main application trends of medical plants cell cultures covering industrial output, technology upgrading and potential resource development. We also provide classification and typification insights to summarize the development of somatic hybridization in cereal, vegetables crops and other medicinal and edible plants as well as application of artificial polyploidy induction in major medicinal herbs. Development medicinal and edible homologous plants based on modern plant cell engineering will bring us a promising future.

Smart City has emerged as the mainstream paradigm for urban governance innovation, sustainable development, and strategy upgrades, which is drawing attention from scholars worldwide. However, current frameworks for Smart City assessment remain incomplete and simplistic. In is paper, 30 national or provincial capitals in China were selected and we designed a tri-dimensional SPI model—Social, Physical, and Information Space—for smart city spatial development assessment. Utilizing methods such as entropy weighting, coupled coordination degree models, and the Dagum Gini coefficient, this study assesses the spatial development and coupled coordination of 30 cities from 2011 to 2019. Finally, by means of BP neural networks, the study examines the contribution of each indicator to the spatial coupled coordination. The results indicated that with a narrowing disparity in development speeds among different regions, the spatial coupled coordination development level of smart capitals in China has steadily increased, presenting a pattern of staggered distribution. Moreover, the IS subsystem plays the most significant role in coupled coordination. The significance of this research lies in its tri-dimensional spatial perspective of the spatial development and coupled coordination differences of the Smart City, providing evidence-based support for the regional layout and optimization in China.

A novel coronavirus (2019-nCoV) was first identified in Wuhan, Hubei Province, and then spreads to the other Provinces of China. 2019-nCoV was reported to share the same receptor, Angiotensin-converting enzyme 2 (ACE2), with SARS-CoV. Previous studies have found ACE2 is abundantly present in humans in the epithelia of the lung and small intestines, and they found ACE2 expression in the basal layer of the non-keratinizing squamous epithelium in nasal and oral mucosa and the nasopharynx. Here based on the public single-cell RNA-Seq datasets, we analyzed the ACE2 expression in the nasal, mouth, lung, and colon tissues. We find that the number of ACE2-expressing cells in the nasal tissue and mouth is comparable to the number of ACE2-expressing cells in the lung tissue and colon. We also find that ACE2 tends to be co-expressed with HLA-DRB1, which plays a central role in the immune system by presenting peptides derived from extracellular proteins, in the nasal, mouth, lung, and colon tissues at single-cell resolution. We hope this provides valuable information for virus-prevention strategy and therapeutic strategy development.

Ovarian cancer is the most frequent cause of deaths in gynecologic malignancies. Many possible mechanisms have been proposed via RNAseq and DNAseq technique recently. However, the driving factors are still obscure. The possible reasons are attributed to the incomplete human reference. This study integrated the canonical mapping-based and mapping-free protocols to extract reliable variations and novel events. We eventually obtained 450 reliable SNVs from the WES data and novel events from the RNAseq data, including 154 SNVs, 462 intron events, two repeats and six splice events. We identified six differentially expressed genes and six contigs that are significantly related to survival prognosis. The recurrent SNVs in significantly differentially expressed genes can be validated in an independent cohort of 20 Chinese ovarian cancer patients.

Forest ecosystems make a greater contribution to carbon (C) stocks than any other terrestrial ecosystem. To understand the role of regional forest ecosystems in global climate change and carbon exchange, forest C stock and its spatial distribution within the small (2,300 km2) Liuxihe River basin were analyzed to determine the different contributors to the C stock. Forest C stocks were quantified by measuring the biomass of trees, understory vegetation, litter and roots, as well as soil organic C, using data from field samples and laboratory experiments. The results showed that forests stored 38.04 Tg C in the entire basin, with secondary and planted forests accounting for 89.82% and 10.18%, respectively, of the stored C. Five types of forests, a subtropical evergreen broad-leaved forest, a subtropical coniferous and broad-leaved mixed forest, a subtropical coniferous forest, a timber forest, and a non-wood forest, stored 257.55 ± 15.01, 218.92 ± 9.59, 195.24 ± 18.29, 177.42 ± 17.55, and 117.86 ± 6.04 Mg C ha−1, respectively. In the forest ecosystem C stocks of the basin, soils averagely contribute about 73.78%, not including root underground biomass. It provides a comprehensive method for forest ecosystem carbon investigation and forest management in small basin scale.

Ship detection from synthetic aperture radar (SAR) imagery is crucial for various fields in real-world applications. Numerous deep learning-based detectors have been investigated for SAR ship detection, which require a substantial amount of labeled data for training. However, SAR data annotation is time-consuming and demands specialized expertise, resulting in that deep learning-based SAR ship detectors struggle due to a lack of annotations. With limited labeled data, semi-supervised learning is a popular approach for boosting detection performance by excavating valuable information from unlabeled data. In this paper, a semi-supervised SAR ship detection network is proposed, termed as Multi-Teacher Dempster-Shafer Evidence Fusion Net-work (MTDSEFN). The MTDSEFN is an enhanced framework based on the basic teacher-student skeleton frame, comprising two branches: the Teacher Group (TG) and the Agency Teacher (AT). The TG utilizes multiple teachers to generate pseudo-labels for different augmentation versions of unlabeled samples, which are then refined to obtain high-quality pseudo-labels by using Dempster-Shafer (D-S) fusion. The AT not only serves to deliver weights of its own teacher to the TG at the end of each epoch, but also updates its own weights after each iteration, enabling the model to effectively learn rich information from unlabeled data. The combination of TG and AT guarantees both reliable pseudo-label generation and learning comprehensive diversity information from numerous unlabeled samples. Extensive experiments were performed on two public SAR ship datasets, and the results demonstrated the effectiveness and superiority of the proposed approach.

Transition metal dichalcogenides (TMDs) monolayers exhibit unique valleytronics properties due to the dependency of the coupled valley and spin state at the hexagonal corner of the first Brillouin zone. Precisely controlling valley spin-polarization via manipulating the electron population enables its application in valley-based memory or quantum technologies. This study uncovered the uncompensated spins of the antiferromagnetic oxide (NiO) serving as the ferromagnetic (FM) order to induce valley spin-polarization in molybdenum disulfide (MoS₂) monolayers via the magnetic proximity effect (MPE). A spin-resolved photoluminescence spectroscopy (SR-PL) was employed to observe MoS₂, where the spin-polarized trions appear to be responsible for the MPE, leading to a valley magnetism. Results indicate that local FM order from the uncompensated surface of NiO could successfully induce significant valley spin-polarization in MoS₂ with the depolarization temperature approximately at 100 K, which is relatively high compared to related literature. This study reveals new perspectives and potential of AFM materials in the field of exchange-coupled van der Waals heterostructures.

The International Roughness Index (IRI) is the standard scale for evaluating road roughness in many countries in the world. The Taipei City government actively promotes a Road Smoothing Project and plans to complete the rehabilitation of the main and minor roads within its jurisdiction. This study aims to detect the road surface roughness in Taipei City and recommend appropriate IRI thresholds for road rehabilitation. A total of 171 asphalt concrete pavement sections in Taipei City with a total length of 803.49 km were analyzed and compared by IRI. The longitudinal profile of the detected road sections was measured using an inertial profiler. The statistical analysis showed that the IRI value prior to road leveling was mainly distributed between 5 and 8 m/km, while the IRI value after road leveling was mainly distributed between 3 and 4.5 m/km. This confirms that the implementation of the Road Smoothing Project has a significant effect on improving road smoothness. Moreover, based on the analysis results, it is recommended that the IRI threshold value for road rehabilitation in Taipei City be set at 4.50 m/km.

Magnetomotive ultrasound (MMUS) is a promising imaging modality for detecting magnetic nanoparticles. In MMUS, an external oscillating magnetic field induces motion of the injected magnetic nanoparticles within tissue, and phase-based tracking algorithms are used to detect the motion. However, the subwavelength scale of theses displacements (often a few micrometers) makes direct visualization on conventional ultrasound B-mode images impossible. In this work, we adapt the Eulerian motion magnification technique to create a novel ultrasound display mode for identifying the nanoparticle locations, eliminating the need for displacement tracking algorithms. Phantom and in-vivo experiments demonstrate that our technique successfully magnifies magnetomotion and the associated shear wave propagation in ultrasound B-mode imaging and pinpoints the nanoparticle vibration source, even in low-concentration scenarios. Additionally, motion magnification magnified the displacement of nanoparticles, having the potential to improve the localization accuracy of displacement tracking algorithms in MMUS.

This article provides a thorough overview of biomarkers, pathophysiology, and molecular pathways involved in the transition from acute kidney injury (AKI), acute kidney disease (AKD) to chronic kidney disease (CKD). It categorizes the biomarkers of AKI into stress, damage, and functional markers, highlighting their importance in early detection, prognosis, and clinical application. The pathophysiological mechanisms underlying AKI, AKD, including renal hypoperfusion, sepsis, nephrotoxicity, and immune responses, with the impact on renal injury. In addition, various molecules play pivotal roles in inflammation and hypoxia, triggering maladaptive repair, mitochondrial dysfunction, immune system reactions, and cellular senescence of renal cell. Key signaling pathways, such as Wnt/β-Catenin, TGF-β/SMAD, and Hippo/YAP/TAZ, promote fibrosis and impact renal function. The Renin-Angiotensin-Aldosterone System (RAAS) triggers a cascade leading to renal fibrosis, with aldosterone exacerbating oxidative stress and cellular changes that promote fibrosis. Clinical evidence suggests RAS inhibitors may protect against CKD progression, especially post-AKI, though more extensive trials are needed to confirm their full impact.

In view of increasing concerns over non-renewable resource depletion and waste management, this study aimed to apply the Taguchi optimization technique to determine the process conditions for producing bricks by incorporating thin film transition liquid crystal displays (TFT-LCD) waste glass powder with reservoir sediments. An orthogonal array L₁₆(4⁵) was adopted, which consisted of five controllable four-level factors (i.e., cullet content, drying method, preheat time, sintering temperature, and error). Moreover, the analysis of variance method was used to explore the effects of the experimental factors on the density, water absorption, shrinkage ratio, loss of ignition, porosity, and compressive strength of the fired bricks. The microstructures of the fired specimens were investigated by scanning electron microscopy. Then, the large-scale production techniques for fired bricks containing recycled TFT-LCD glass cullet and reservoir sediments was developed in a commercially available tunnel kiln. The test results showed that the structure of fired specimen was loose at a sintering temperature ranged from 900–950 °C. However, the fired specimen showed a significant densification at the sintering temperature of 1050 °C. In addition, Taguchi method is a feasible approach for optimizing process condition of brick using recycled TFT-LCD glass cullet and reservoir sediments and it significantly reduces the number of tests. On the other hand, the characteristics of fired bricks developed in the tunnel kiln were in compliance with Chinese National Standards class Ι building bricks criteria.

In Southeast Asia, the Malayan Pit Viper (Calloselasma rhodostoma) is a venomous snake species of medical importance and bioprospecting potential. To unveil the diversity of its toxin genes, this study assembled and analyzed the de novo venom gland transcriptome of C. rhodostoma from Malaysia. The expression of toxin genes dominates the gland transcriptome by 53.78% of total transcript abundance (based on overall FPKM), in which 92 non-redundant transcripts belonging to 16 toxin families were identified. Snake venom metalloproteinase (SVMP, PI&gt;PII&gt;PIII) is the most dominant family (37.84% of all toxin FPKM), followed by phospholipase A2 (29.02%), bradykinin/angiotensinogen-converting enzyme inhibitor-C-type natriuretic peptide (16.30%), C-type lectin (CTL, 10.01%), snake venom serine protease (SVSP, 2.81%), L-amino acid oxidase (2.25%) and others (1.78%). The expressions of SVMP, CTL and SVSP correlate with hemorrhagic, anti-platelet and coagulopathic effects in envenoming. The SVMP metalloproteinase domains encode hemorrhagins (kistomin and rhodostoxin), while disintegrin (rhodostomin from P-II) is platelet-inhibitory. CTL gene homologues uncovered include rhodocytin (platelet aggregators) and rhodocetin (platelet inhibitor), which contribute to thrombocytopenia and platelet dysfunction. The major SVSP is a thrombin-like enzyme (ancrod homolog) responsible for defibrination in consumptive coagulopathy. The findings provide insight into the venom complexity of C. rhodostoma and the pathophysiology of envenoming.

This article addresses the trajectory tracking between two non-identical systems with chaotic properties. We employ the Rossler chaotic and RCL-shunted Josephson junctions model in similar phase space to study trajectory tracking. In order to achieve the goal tracking, we afford two stages to approximate the target tracking. The first stage utilizes the active control technique to transfer the output signal from the RCLs-J system into the quasi-Rossler system. Then next, the RCLs-J system employs the proposed the iterative learning control scheme and the control signal from the drive system to trace the trajectory of Rossler system. The numerical results demonstrate the proposed method and the tracking system is asymptotically stable.

This research not only dedicated a less restrictive method of iteration-varying function for a learning control law to design a controller but also synchronize two nonlinear systems with free time-delay. In addition, the mathematical theory of system synchronization has proved rigorously and the theory verified through an example to demonstrate the behavior of each parameter in the theory. The design of a controller using the iterative learning control law is significant for robotic tracking. The controller in this research generates a feed-forward control input using the error dynamics among the drive-response systems. The error dynamics satisfies the Lyapunov function and the combination of output errors, which respectively represented relative estimated differences of the drive-response systems. The iterative learning control rule serves the function of a filter adding previous control error after the end of each iteration. The numerical example of a synchronous system is given a Lorenz system for driving and another with the iterative learning control law for response under different initial condition. The results verify and demonstrate the proposed mathematical theory. The simulation exhibits consistency in the behavior of each parameter to match mathematical theory.

The study aimed to estimate the prevalence and associated factors of cervical and breast cancer screening among women in the general population in Jordan. Nationally representative cross-sectional data were analysed from 14,689 women (34 years median age, range 15-49) that took part in the “2017-18 Jordan Population and Family Health Survey”. Information about cancer screening uptake included Pap smear, clinical breast examination, and mammography. Results indicate that the prevalence of ever Pap smear cancer screening was 15.3%, clinical breast examination in the past 12 months 13.9% and ever mammography 8.7%. In adjusted logistic regression analysis, older age, higher wealth, greater media exposure and tobacco use were positively and being Syrian, and living in the southern region were negatively associated with ever Pap smear, clinical breast examination in the past 12 months, and ever mammography. In addition, high decision-making power was associated with the uptake of Pap smear and higher education was associated with ever mammography. The study showed a low cancer screening uptake, and several factors were identified that can assist in promoting cancer screening in Jordan.

In all areas of medicine, especially in radiology, computers are increasing year by year. Filmless radiology, speech recognition software, electronic application forms, and teleradiology are recent developments that have greatly improved radiologists' performance. This research explores radiology software trends, predictions, and the challenges posed by informatics and historical trend analysis. The rationale behind this research is that information technology (IT) is overgrowing almost every day. We must continuously seek new ways to apply IT to make more use of resources. Consequently, IT becomes increasingly crucial to radiology organizations' innovative thinking, workflow, and business models. This study aimed to analyze all radiology software publications in the Science Citation Index (SCI). From 1991 to July 2021, SCI was used to search for publications systematically. We have also widely used this historical method in radiology software research. The findings and discussions are base on an assessment of trends, predictions, contributions, and challenges in radiology software, and we are exploring radiology software with six evolutionary stages. The gift of this research is that radiology managers realize that the use of new information technologies is closely related to survival in a competitive environment. Radiology companies can review these new technologies to develop more innovative business models and services to improve operational deficiencies.

Taiwan is the world’s leading country regarding tuna longline fisheries; the combined catches with those from Japan account for more than half of the global total. However, the bycatch of sea turtles, seabirds, and dolphins in longline fisheries has attracted international concern. Regarding sea turtle conservation, the use of circle hooks in longline fisheries will inevitably become a trend. Meanwhile, Taiwanese fishermen are concerned whether the use of circle hooks will have a negative impact on the catch efficiency of target species. This study was conducted to compare the catch efficiency of circle and tuna hooks by the Taiwanese commercial tuna longline fishing vessels in the eastern Pacific Ocean. The results indicated that if the effects of immersion time were considered, the catch rates of all groups were the same between 4.2-sun circle and tuna hooks. However, the catch rate of 4.0-sun circle hooks was significantly higher than the two types of 4.2-sun circle and tuna hooks. Regarding survival rates, fish caught with circle hooks showed higher survival rates than tuna hooks for total commercial fish, tunas and yellowfin tuna (Thunnus albacares). However, the survival rate was only determined at haulback; the relationship between survival rate and immersion time still needs further investigation. Regarding catch sizes, there were no significant differences in the sizes of bigeye (Thunnus obesus) and yellowfin tuna between circle and tuna hooks. But based solely on mean weight, the value of yellowfin tuna caught using circle hooks may be higher than those using tuna hooks. In summary, the circle hooks used in this study did not show a negative impact on the catch efficiency of Taiwanese longline fisheries, and could show a superior performance than that of tuna hooks. These results could be actively promoted in the industry through the education and training of fishermen; thus enabling Taiwan to comply with international sea turtle conservation trends.

In this nano era, nanomaterials and nanostructures are popular in developing novel functional materials. However, the combinations of nanoproducts with materials at micro and macro scale can open new routes for conceiving novel materials with an improved or even new functional performances. In this study, a brand-new hybrid, containing both nanofibers and particles having a microsize, was fabricated using a sequential electrohydrodynamic atomization (EHDA) process. Firstly, the microparticles loaded with drug (berberine hydrochloride, BH) molecules in the cellulose acetate (CA) were fabricated using a solution electrospraying process. Later, these microparticles were suspended into a co-dissolved solution containned BH and a hydrophilic polymer (polypyrrolidone, PVP), and were co-electrospun into the nanofiber/microparticle hybrids. The EHDA processes were clearly recorded, and the resultant products showed a typical hybrid topography, with microparticles distributed all over the nanofibers, which was demonstrated by SEM assessments. FTIR and XRD demonstrated that the components within the hybrids were presented in an amorphous state and have fine compatibility with each other. In vitro dissolution tests verified that the hybrids were able to provide the designed dula-step drug release profiles, a combination of the fast release step of BH from the hydrophilic PVP nanofibers through an erosion mechanism and the sustained release step of BH from the insoluble CA microparticles via a typical Fickian diffusion mechanism. The present protocols pave a new way for developing trans-scale functional materials.

Taiwan's bed and breakfast (B&B) development has been more than 25 years ago, from the first generation of retirement to the B&B industry, serving tourists from all over the world accom-modation, providing breakfast and accommodation mode to the present, after the change of employees from the second generation, more and more attention is paid to the cultivation and cultivation of business ability. With the advent of the era of AI technology networking, the ca-pabilities required for B&B operation are more focused on all aspects of service, and the good marketing ability of B&B can promote a green chimney-free tourism economy, which is also a favorite industry of various governments and the public. This study explores the basic vocational competency indicators required for running a B&B, with (1)EQ emotion management skills, (2)Financial management ability, (3)(SK) technical skills, and (4)Marketing and promotion management capabilities. Through the study method, the K-S Z test was determined by the con-sensus conclusion of expert reliability and validity p value

This study investigates the transformative impact of ChatGPT, a cutting-edge AI language model developed by OpenAI, on the financial sector. We explore ChatGPT's applications in financial analysis, focusing on its ability to perform tasks traditionally handled by human analysts. By creating a set of multi-step and advanced reasoning financial tasks, and establishing several task-specific evaluation metrics, our experimental results demonstrate that ChatGPT-4o can effectively perform both basic and some complex financial analysis tasks comparable to those executed by humans. However, our empirical evaluation reveals limitations in its performance on complex tasks that require comprehensive understanding and critical thinking. The study highlights the necessity for meticulous task formulation and robust evaluation to achieve consistent functionality. While ChatGPT enhances efficiency in financial analysis, its integration with human expertise remains crucial for effective decision-making. This study contributes to the understanding of AI's role in finance and provides insights into its potential and constraints, guiding future integration of AI technologies in financial practices.

Background: Gastric cancer (GC) is one of the leading malignancy diseases worldwide, especially in Asian. CAST is a potential oncogene in GC carcinogenesis process. The character of macrophage infiltration in GC microenvironment was also unaddressed. Methods: We first applied machine searching in gene candidate evaluation of GC. CAST expression was analyzed via the Human Protein Atlas (HPA) and Gene Expression Profiling Interactive Analysis 2 (GEPIA2) database. Protein-protein interaction (PPI) network was downloaded from STRING. We investigated the impact of CAST on clinical prognosis using Kaplan-Meier plotter. The correlations between CAST and Lgr5 and macrophage infiltration in GC was surveyed via TIMER 2.0. Finally, GeneMANIA was also used to evaluate the possible functional linkage between genes. Results: After machine-assisted searching, CAST expression was found signicant difference in the overall survival of GC patients. STRING revealed CAST related proteomics and transcriptomics associations, mainly about CAPN family. Moreover, CAST significantly impacts the prognosis of GC from other datasets validation. Notably, high CAST expression was correlated with worse overall survival in GC patients (hazard ratio = 1.59; logrank P = 9.4 x 10-8). CAST and Lgr5 expressions were both positively correlated with WNT 2 and WNT 2B. Among GC patients in several datasets, CAST and macrophage infiltration evaluated together showed no obvious trend toward poor clinical overall survival. Conclusion: CAST plays an important role in GC clinical prognosis and is associated with WNT 2/WNT 2B/Lgr5. Our study denmostrated that CAST in GC overall survival is regulated by macrophage infiltration.

By repeated unloading and loading of the excavation dynamic and static loads, repeated train dynamic and static loads of multi-factors, the underpass tunnel, cross tunnel engineering influence area rock layer, the existing tunnel structure of the three constitutes a multifaceted structure, multi-factor interaction system. Existing tunnels into the prediction theory model of the new tunnel excavation process of dynamic and static loads, dynamic and static loads of existing tunnels are mostly analyzed individually, the results of synergistic analysis needs to be improved. Based on the theory of the current layer method, the paper comprehensively considers the stiffness of the existing tunnel, the stiffness of the new tunnel, the excavation method load and the existing tunnel load, coupled with Peck's empirical formula, the theoretical model of deformation prediction for excavation of a two-lane highway tunnel under the tunnel through the existing railroad is proposed, and verified and optimized by numerical calculations and monitoring data, which proves the applicability and reliability of the theoretical model in the similar strata and the project promotion.

The research on the excavation mechanical properties of underpass tunnels has already had certain results, but fewer of them consider the effects of dynamic and static loads on the excavation mechanical properties of underground tunnels at the same time, especially the lack of research cases of double-line highway tunnels with angled underpasses of existing railway tunnels. In this paper, based on the tunnel project of the new double-line Shiqian Highway Tunnel passing under the Hurong Railway at an oblique angle, the mechanical parameters of the rock body in the cross-tunneling area under the influence of static and dynamic load coupling are obtained by using the disturbance quantification coefficients and the Hoek-Brown criterion based on the method of over-advanced geological prediction and the investigation of the surrounding rock on the palisade face, and the engineering-scale finite element model is constructed and the mechanical characteristics of the excavation in the tunnel of the double-lane highway tunnel passing under the existing railroad under the influence of the static and dynamic loads are analyzed. The results show that: the new tunnel rock movement law for the top of the arch sinking, bottom plate bulging, side wall to move outward, the height and width of the arch and bottom plate arch with the tunnel excavation and increase, the side wall rock displacement effect is smaller; left and right lines of the tunnel disturbed area of the rule of change is similar; the existing tunnel bottom plate displacement is more than the top plate and the left and right side walls by the excavation of the time step influence is larger. Typical profile displacement is mainly determined by the distance from the excavation surface; the new tunnel in the four types of calculation conditions of the rock disturbance angle is the same; the existing tunnel roof and side wall Von Mises stress extreme occurs in the tunnel structure, the bottom plate there are pressure relief and pressure-bearing areas; based on the displacement control criteria, the recommended upper and lower step blasting method.

This study examined the use of high dosages of ultraviolet germicidal irradiation (UVGI) (253.7 nm) to deal with various concentrations of air pollutants, such as formaldehyde (HCHO), total volatile organic compounds (TVOC), under various conditions of humidity. We also estimated the emission of ozone as a secondary pollutant of UVGI as treatment. A number of irradiation methods were applied for various durations in field studies to examine the efficiency of removing HCHO, TVOC, bacteria, and fungi. The removal efficiency of air pollutants (HCHO and bacteria) through long-term exposure to UVGI appears to increase with time. The effects on TVOC and fungi concentration were insignificant in the first week; however, improvements were observed in the second week. No differences were observed among the various irradiation methods in this study regarding the removal of HCHO and TVOC; however significant differences were observed in the removal of bacteria and fungi.

The purposes of this study are to analyze the groundwater quality of Ogallala Aquifer and evaluate the hydrological characteristics in the southern High Plains region of the Permian Basin, Texas. Levels of chloride, fluoride, nitrate, pH, selenium, and total dissolved solids (TDS) were analyzed through the years 1990-2016. A total of 133 wells were collected from the Texas Water Development Board (TWDB) which is an open database by the US government. Statistical analysis was utilized to evaluate the groundwater quality and propose trends. The average levels of the contaminants were compared to their respective Maximum Contaminant Levels (MCL) by the Environmental Protection Agency (EPA). Potential human health risks that each contaminant possesses were described. Possible sources of each contaminant were discussed with oil/gas activities, agricultural practices, and other human actions impact its conditions. This research provides important information for groundwater quality of Ogallala aquifer and contributes on understanding the response to development in the Permian Basin, Texas.

Promoting close and sustainable cooperation between schools, enterprises, and government has become an important concern in many countries. Based on evolutionary game theory, this paper constructs a tripartite evolutionary game model of schools, enterprises, and government in order to analyze the stability of strategies of the different players. The results show that the main factor that influences the stability of the strategies of schools and enterprises is the reward of positive cooperation from sources other than the government, and the main factor that influences the stability of the strategy of the government is the benefit of positive cooperation strategy under the scenario where schools cooperate with enterprises. Therefore, the government should focus on implementing more effective policies, such as increasing the incentives and penalties, improving the mechanism for managing conflicts, ensuring the fairness of benefits distribution, and clarifying the responsibilities of different departments; schools should focus on providing more practical curricula and programs for students, training high-quality teachers, and perfecting talent cultivation to meet the needs of enterprises; and enterprises should focus on providing job experiences for students and transforming the results of schools’ teaching and theoretical research into practical productivity.

In order to study the petrogenesis and tectonic setting of Permian A-type granites and their relationships with hydrothermal mineralization along the Hegenshan-Heihe suture zone (HHSZ) in northeastern China, we select the newly discovered Hongyan Cu-polymetallic deposit in the northeastern part of the HHSZ that develops three stages of mineralization associated with the Shanshenfu alkali-feldspar granite (SAFG). The zircon U-Pb dating and whole rock geochemistry suggest that the SAFG is a typical A-type granite formed in the Early Permian. The zircon Hf isotopes and trace elements suggest that the SAFG has high Ti-in-zircon temperature (721–990℃), high magmatic oxygen fugacity and largely positive εHf(t) (+6.0 to +9.9). Therefore, we propose that the SAFG was derived from the crustal assimilation and fractional crystallization of the charnockitized juvenile crust. The high oxygen fugacity favors the chalcophile elements (e.g., Cu, Au, Ag) of the source region enriched in the fluid phases after magmatic fractional crystallization, consequently facilitating subsequent hydrothermal mineralization, which is also consistent with the characteristics of ore-forming fluids that changed from the initial high temperature, high salinity, high fO2 and CO2-rich magmatic-hydrothermal fluids of stage I to CO2-poor, dilute, and cooling meteoric fluids of stage III. Combined with regional geological background, the Permian A2-type granites along the HHSZ can be formed in post-collisional slab break-off process. In subsequent exploration for hydrothermal deposits along the HHSZ, the Permian A-type granites with arc-related juvenile crustal source and high fO2 have great potential and need more attention.

In this paper, the overall performance of Cu-(In,Ga)-Se₂ (CIGSe) solar cells was improved in the ultraviolet (UV)–visible wavelength region by two-segment process. In which, adjusting DC sputtering powers (20–40 W) for absorbers (segment I), and metal-alloy compositions (CdS, ZnO/CdS, ZnMgO/CdS and ZnMgO) for buffers (segment II) were explored and characterized. Upon choosing the optimal-30-W CIGSe-absorber (with 0.95-CGI ratio) sputtered by the segment-I process, the Cu-rich film can distinctly boost grain growth, thus reducing the trap state density. After segment-II process as the toxic-CdS alternative, the optimal Zn_0.9Mg_0.1O-alloy buffer can reach the best conversion efficiency (η = 8.70%) was attained for the environmental protection. Meanwhile, and the overall internal/external quantum efficiencies (IQE/EQE) were improved by 13.15%, respectively for the 2.48–3.62-eV bandgap (short wavelength) range. The developed photovoltaic (PV) module (with 9 optimum-CIGSe cells) exhibits acceptable stability with a variance within ±5% over the 60-day experiment. This discovery in PV-device research contributes to a new scientific understanding of renewable energy. Furthermore, this study undeniably enhances the progress of practical applications for PV-modules in alignment with sustainable development goals. It also actively supports the development of eco-friendly communities.

In view of the problem of cracking easily and partial distortion of images after encryption or decryption, a novel image encryption and decryption algorithm based on Arnod Transform and fractional chaotic is proposed. To begin with, the Arnold transform is used to encrypt. So that the spatial confidence of the original image has been comprehensively disturbed. Secondly, the XOR involving the fractional order chaotic sequence is used to encrypt. The key sequence is dynamically generated to ensure the randomness and difference of key generation. When decryption is required, the first decryption is performed using the key and XOR. Then the second decryption is carried out by using the inverse Arnold transform, and finally the decrypted image is obtained. Experimental results show that the improved algorithm has achieved better performance in encryption and decryption.

The evaluation of tourism sustainability has become of paramount importance for researchers and decision-makers to better protect tourist destinations, especially with the continuous increase in the number of tourists and visitors that alter the natural components of the environment and degrade ecosystems. Therefore, the use of geographical data is of great significance, particularly in environmental monitoring and land management, due to its ease of use and availability. However, calculating composite indices for sustainability involves several steps and requires a basic understanding of existing models. This article describes the development and design of a package of plugins in QGIS that serves as an easy-to-use tool for processing and automatically calculating economic, environmental, social indices, and the overall index of tourist sustainability. These plugins have been built in Python and designed as QGIS software plugins.

This study encourages volunteer managers to innovate when enhancing volunteers' organizational commitment by adopting the new variable of psychological ownership, thus creating new management practices and systems. The findings indicate that psychological ownership significantly affects organizational commitment and can also enhance it through the partial mediating effect of volunteer motivation. Evidently, psychological ownership can become a major factor influencing volunteer retention. Consequently, two innovative management strategies are suggested to foster volunteer organizational commitment: Firstly, construct a diverse knowledge base for volunteer managers, facilitating a cognitive shift in leaders to enhance leadership, achieve better information sharing, and collaboration using diverse knowledge. Secondly, treat the organization's volunteers as a subsystem, develop psychological ownership as the foundation for system operations, integrate the volunteer system with the staff system through a decentralized decision-making structure, 'empower' the volunteer system, and stimulate members' sense of participation and responsibility, thereby fostering innovation and continuous improvement.

This research uses ARM-based FPGA to implement the computation of a virtual-real fusion hardware system. It also evaluates the acceleration effect of virtual-real fusion execution speed after connecting related hardware acceleration and provides a reference for real-time information fusion system design. The hardware uses Xilinx Zynq UltraScale+ MPSoC ZCU102 Evaluation Kit. It also obtains color and depth images with Intel® RealsenseTM D435i depth cameras. This system receives image data through the Linux system built on the ARM and fed to the FPGA for object detection using CNN models. In addition, it develops a module for rapidly performing registration between the color images and the depth images. It can calculate the size and position of the display information on the transparent display according to the pixel coordinates and depth values of the human eye and the object. The fusion took about 47ms on a personal computer with a GPU RTX2060 and 25ms on the ZCU102. The acceleration is nearly 168%. Finally, the results were successfully transplanted into the retail display system for demonstration.

In order to establish a new discipline specializing in accident science from the perspective of safety science. Under the guidance of the current research theories and methods of safety science, combined with the research paradigm of humanities and social medicine, this paper puts forward new viewpoints, new theories and new models about accident research. First of all, through literature retrieval, this paper analyzes the relevant research results of accidents at home and abroad, and expounds the existing problems and the basic trend of accident science research. Secondly, it puts forward eight kinds of attribute relations of the accident, and makes clear the characteristics and connotation of the accident. In the study of accident types, a hierarchical classification model based on accident cognition is created for the first time. It also points out the logical relevance of five levels of accident science research and the realistic relevance of three levels. At the same time, according to the thought of science of science, this paper puts forward a new definition of safety under the thinking of accident science and other basic concepts related to safety science, and explains the connotation. In addition, it creates and constructs the basic concept of accident science, establishes the conceptual model of accident science, and points out the “3-4-5” model of accident science research and its connotation. Thirdly, draw lessons from the interdisciplinary paradigm to study the relevant theoretical basis and discipline classification relationship of accident science, and construct the tree of accident science. Finally, the research contents of three main aspects of accident science are summarized. The results show that the research results in this paper not only play a fundamental role in the basic construction of accident science, but also further enrich and perfect the discipline system of safety science, which has a certain theoretical significance.

Resource Description Framework(RDF) is a data representation format of the Semantic Web, and its data volume is growing rapidly. Cloud-based systems provide a rich platform for managing RDF data. However, the distributed environment has performance challenges when it is processing with RDF queries that contain multiple join operations, such as network reshuffle, memory overhead. To get over these challenges, this paper proposed a spark-based RDF query architecture, which is based on Semantic Connection Set (SCS). First of all, this spark-based query architecture adopts the mechanism of re-partitioning class data based on vertical partitioning, which can reduce memory overhead and fast index data. Secondly, a method for generating query plans based on semantic connection sets is proposed in this paper. In addition, statistics and broadcast variable optimization strategies are used to reduce shuffling and data communication costs. The experiment of this paper is based on the latest SPARQLGX on the spark platform RDF system, two synthetic benchmarks are used to evaluate the query. The experiment result illustrates that the proposed approach in this paper is more efficient in data search than SPARQLGX.

Because only two variables are needed to characterize a simple thermodynamic system in equilibrium, any such system is constrained on a 2D manifold. Of particular interest are the exact 1-forms on the cotangent space of that manifold, since the integral of exact 1-forms is path-independent, a crucial property satisfied by state variables such as internal energy dE and entropy dS. Our prior work [1] shows that given an appropriate language of vector calculus, a machine can re-discover the Maxwell equations and the incompressible Navier-Stokes equations from data. In this paper, We enhance this language by including differential forms and show that machines can re-discover the equation for entropy dS given data. Since entropy appears in various fields of science in different guises, a potential extension of this work is to use the machinery developed in this paper to let machines discover the expressions for entropy from data in fields other than classical thermodynamics.

The performance of the absolute atom gravimeters used on moving platforms, such as vehicles, ships and aircrafts, is strongly affected by the vibration noise. To suppress its influence, we summarize a vibration compensation method utilizing data measured by a classical accelerometer. The measurements with the accelerometer show that the vibration noise in the vehicle can be 2 order of magnitude greater than that in the lab during daytime, and can induce an interferometric phase fluctuation with a standard deviation of 16.70π. With the compensation method, our vehicle-mounted atom gravimeter can work normally in these harsh conditions. Comparing the Allan standard deviations before and after the vibration noise correction, we find a suppression factor of 22.74 can be achieved in static condition with an interrogation time of T = 20 ms, resulting a sensitivity of 1.35 mGal/Hz1/2, and a standard deviation of 0.5 mGal with an average time of 10 s. We also demonstrate the first test of an atom gravimeter in a moving vehicle, in which a suppression factor of 50.85 and a sensitivity of 60.88 mGal/Hz1/2 were realized with T = 5 ms.

Abstract: NFinFET transistors with fin channel length 90nm and a planar MOSFET transistor with channel length 180nm and 90nm are presented with characteristic curves at various gate biases. A finalized algorithm with kink effects is effectively responsible for addressing the field effect transistors. The algorithm includes the modified conventional current-voltage formula and a nonlinear heat-associated kink solution which is simplified as a Gaussian form. Three parameters in modified model includes kN (related with channel width, channel length, and gate oxide capacitor, and proportional to the mobility of carriers)Vth(Threshold Voltage), and (the inverse of Early Voltage). Those parameters are determined to minimize the discrepancies between the measured data and the fitting values, but leave kinks located at around (VGS－Vth), which are deliberately eliminated by the Gaussian form because of the agitation of thermal kink effects. The whole fitting is made to be as close as the as-measured IDS-VDS. In the mean time, those determined parameters are physically meaningful after the analysis has been done.

Excessive body fat is a major contributor to obesity, which is related to high blood, total cholesterol and triglycerides. Lemons (Citrus limon) are renowned for their antioxidant and lipid-lowering properties. First, Sugar-free fermentation demonstrated better results lower sugar content and was identified as the preferred fermentation method. Next, the effect of two doses of sugar-free fermented lemon peel juice (SF-FLPJ) on obesity was investigated. Sprague Dawley (male rats) were randomly divided into 4 groups and fed a standard feed or high-fat diet (HFD) to induce fatness for eight weeks. The two groups of rats fed an HFD were administered SF-FLPJ at 0.45 or 0.9 g/kg body weight daily for eight weeks. The obese rats administered 0.9 g/kg (body weight/day) of SF-FLPJ exhibited significant reductions in body fat mass and percentage; they also had lower blood cholesterol and triglyceride levels than the other groups. Additionally, the rats displayed diminished liver fat accumulation. The results suggest that SF-FLPJ can be a supplement in managing body fat, contributing positively to addressing obesity within the context of health management, and reduce obesity-associated issues.

Taxanes, particularly docetaxel (DTX), has been widely used for combination therapy of head and neck squamous cell carcinoma (HNSCC). For locally advanced unresectable HNSCC, DTX combined with cisplatin and 5-fluorouracil as a revolutionary treatment revealed an advantage in improvement of patient outcome. In addition. DTX plus immune check inhibitors (ICIs) showed low toxicity and increased response of patients with recurrent or metastatic HNSCC (R/M HNSCC). Accumulating data indicate that taxanes not only function as antimitotics but also impair diverse oncogenic signalings including angiogenesis, inflammatory response, ROS production, and apoptosis induction. However, despite an initial response, development of resistance remains a major obstacle to treatment response. Taxane resistance could result from intrinsic mechanisms such as enhanced DNA/RNA damage repair, increased drug efflux, and apoptosis inhibition, and extrinsic effects such as angiogenesis and interactions between tumor cells and immune cells. This review provides an overview of taxanes therapy applied in different stages of HNSCC and describe the mechanisms of taxane resistance in HNSCC. Through a detailed understanding the mechanisms of resistance may help developing the potential therapeutic methods and the effective combination strategies to overcome drug resistance.

This paper proposes a new non-radial biennial Luenberger energy and environmental performance index (EEPI) to measure the EEP change in various Chinese cities. The sources of EEP change, in terms of technical efficiency change and technological change, are examined by Luenberger EEPI. The contributions from specific undesirable outputs and energy inputs to the EEP change are identified by means of the non-radial efficiency measure. The proposed approach is applied to evaluate the EEP of the industrial sector in 283 cities in China over 2010-2014. Factors influencing the emission abatement potential are investigated by employing geographically weighted regression (GWR) model. We find that 1) changes in EEP can be attributed to technological progress but that technological progress slows down across the study period; 2) the soot emission performance experiences a downtrend among four specific sub-performances in line with the truth that severe haze happened frequently in China; 3) the best performers begin to move from the coastal to inland cities with the less resource consumption and higher ecological equality; 4) cities with the strongest positive effect in regards to pollution intensity on emission abatement potential are located in the areas around the Bohai Gulf, where air pollution is particularly severe.

Our study explores the role of cancer-derived extracellular exosomes (EXs), particularly focusing on collagen alpha-3 (VI; COL6A3), in facilitating tumor dissemination and metastasis in epithelial ovarian cancer (EOC). We found that COL6A3 is expressed in aggressive ES2 derivatives, SKOV3 overexpressing COL6A3 (SKOV3/COL6A3), and mesenchymal-type ovarian carcinoma stromal progenitor cells (MSC-OCSPCs), as well as their EXs, but not in less aggressive SKOV3 cells or ES2 cells with COL6A3 knockdown (ES2/shCOL6A3). High COL6A3 expression correlates with worse overall survival in EOC patients, as evidenced by TCGA and GEO data analysis. In vitro experiments showed that EXs from MSC-OCSPCs or SKOV3/COL6A3 cells significantly enhance invasion ability in ES2 or SKOV3/COL6A3 cells, respectively (both, P &lt;0.001). In contrast, ES2 cells with ES2/shCOL6A3 EXs exhibit reduced invasion ability (p&lt;0.001). In vivo, the average disseminated tumor numbers in the peritoneal cavity were significantly greater in mice receiving intraperitoneally injected SKOV3/COL6A3 cells than in SKOV3 cells (p&lt;0.001). Furthermore, mice intravenously (IV) injected with SKOV3/COL6A3 cells and SKOV3/COL6A3-EXs showed increased lung colonization compared to mice injected with SKOV3 cells and PBS (p=0.007) or SKOV3/COL6A3 cells and PBS (p=0.039). Knockdown of COL6A3 or treatment with EXs inhibitor GW4869 or rapamycin-abolished COL6A3-EXs may suppress the aggressiveness in EOC.

To determine the fracture rate of ceramic crowns and causes of ceramic crown failure, this study used keywords—namely “endocrown,” “veneered fixed dental prosthesis,” “monolithic lithium disilicate (LS2),” and “all-ceramic single crown”—to search for articles published in English from 2005 to 2023 in the PubMed electronic database. Rather than using the Boolean logic algorithm between MESH terms and keywords, we accurately calculated the numbers of final clinically tracked cases with crown fractures from the contents of articles. The titles and abstracts of many related articles focused on implant or abutment fracture, while crown fracture was investigated and mentioned only in the main texts of the articles. Our studies included those crowns as well as having more complete data collection. Our search yielded 228, 93, 404, and 358 articles for the keywords “endocrown,” “veneered fixed dental prosthesis,” “monolithic lithium disilicate (LS2),” and “all-ceramic single crown,” respectively. We used the Newcastle–Ottawa Scale (NOS) to assess article quality, and our inclusion criteria were randomized controlled trials (RCT) and cohort study articles involving more than 3 years of follow-up and more than 20 cases. After reviewing, 16 high-quality articles were selected for analysis. The 4.4% crown fracture rate recommended on the basis of most clinical results was achieved in only 6 of the 16 articles. In these 6 articles, the researchers concluded the following reasons that may cause the crown fractures: the thickness of the veneer ceramic material; the connector dimensions; pontic span of the fixed prosthesis; the type of cement; the treatment of the ceramic surface before luting. Other articles inferred that the computer-aided design libraries that were insufficient for the creation of appropriate anatomically supported frameworks for prostheses with ceramic veneers; the thermal expansion coefficient and fracture toughness of the framework material did not match those of the veneer ceramic, resulting in an insufficient area supporting the ceramic veneer then leads to premature crown failure after a long period chewing. The future prospective for material developing could focus on solving those problems and have better clinical results.

This study aimed to compare the differences in durability and prestress loss between normal-weight concrete (NC) and lightweight aggregate concrete (LWC) prestressed box girders, which were constructed at the same time in the same area, so as to verify the superiority of using synthetic lightweight aggregate (LWA) made from reservoir sediments in prestressed bridges. For the NCs and LWCs used in prestressed box girders, the basic mechanical properties were tested on the one hand, and the durability properties were tested on the other hand. Then, through the prestress monitoring system, the prestress loss of the two groups of the prestressed box girders was tracked. The results of the durability test confirmed that LWC can inhibit the penetration of air, water, and chloride ions by strengthening the interfacial transition zone between the aggregate and the cement paste, thereby improving its durability. Moreover, the magnetic flux prestress loss of the NC prestressed box girder reached 8.1%. In contrast, the magnetic flux prestress losses on both sides of the LWC prestressed box girder were 4.6% and 4.9%, respectively. This verified that, under the same environmental conditions, the use of LWC produced less of a prestress loss than the use of NC.

Heat dissipation from Li-ion batteries is a potential safety issue for large-scale energy storage applications. Maintaining low and uniform temperature distribution, and low energy consumption of the battery storage is very important. We studied the fluid dynamics and heat transfer phenomena of a single cell, 16-cell modules, battery packs, and cabinet through computer simulations and experimental measurements. The results show that the temperature distribution of single cell is relatively uniform when the cell is facing the air flow. In a module, very high air flow rate and large gap between the cells can reduce the cell temperature. A pack with a good thermally conductive case is very important to ensure good heat dissipation of the battery module. Due to limited space in the cabinet, additional air inlets and outlets can be opened outside of the cabinet to slightly lower the pack temperature. Installing fins outside the cabinet can also slightly reduce the temperature inside the cabinet. Liquid cooling medium, such as water, is much better than the air-cooling medium.

Abstract: This study evaluates the effect of paravertebral spinal injection (PSI), utilizing both subjective and objective assessments in chronic low back pain (LBP) associated with facet joint arthrosis over a one-month duration. Subjective questionnaires included the Visual Analogue Scale (VAS) for pain, Oswestry Disability Index, Health Survey SF-12, and the short Falls Efficacy Scale International (FES-I). Objective assessments included in-clinic gait and timed-up-and-go (TUG) tests using wearable sensors, as well as 48-hour daily physical activity (DPA) monitored using a chest-worn tri-axial accelerometer. Subjective and objective measures were performed prior to treatment, immediately after the treatment, and one-month afterthe treatment. Eight LBP patients were recruited for this study (mean age = 54±13 years, body mass index = 31.41±6.52 kg/m2, 50% males). Results show significant decrease in pain (~55%, p<0.05) and disability (Oswestry scores, ~21%, p<0.05). In-clinic gait and TUG were also significantly improved (~16% and ~18% faster walking and shorter TUG, p<0.05); however, DPA (including percentage of physical activities (walking and standing) and the number of steps) showed no significant change after PSI (p>0.25; effect size≤0.44). We hypothesize that DPA may continue to be truncated by conditioned fear-avoidance, a psychological state that may prevent increase in daily physical activity to avoid pain.

Aging and obesity make humans more prone to cardiovascular and metabolic syndrome diseases, leading to several serious health conditions, including dyslipidemia, high blood pressure, and sleep disturbance. Hyperlipidemia means elevated blood lipid levels, including cholesterol and triglycerides. This study aimed to explore the hypolipidemic effect of fermented citrus lemon juice using a hyperlipidemic hamster model. Sugar-free lemon juice’s fermentation was optimized, and the characteristics of fresh and fermented lemon juice (FLJ) were evaluated and compared. In addition, tests were conducted to determine the appropriate hamster feed for the functional animal tests. Then, experiments were conducted to evaluate the hypolipidemic effect of the FLJ, which contained polyphenols and superoxide dismutase-like activity, on a hyperlipidemic hamster model. This study’s pre-fermentation efficiency evaluation found that 21–30 days of bacterial DMS32004 and DMS32005 fermentation of fresh lemon juice provided the best fermentation benefits. In addition, the fermentation evaluation showed that a sugar-free fermentation method provided FLJ with the best benefits. Results showed that the absorption and utilization efficiency of FLJ was higher compared with the unfermented lemon juice. After six weeks of feeding, the total cholesterol and triglyceride values in the blood and liver of the FLJ treatment groups were de-creased compared with the high-fat diet (HFD) group. In addition, the blood low-density lipoprotein cholesterol levels were significantly reduced in the FLJ treatment groups compared with the HFD group. In contrast, the blood high-density lipoprotein to low-density lipoprotein cholesterol ratio increased considerably in the FLJ treatment groups, and the total to high-density lipoprotein ratio was significantly lower than in the HFD group. Compared with the HFD group, the total cholesterol content in the FLJ treatment groups’ feces increased significantly. This study demonstrated that the sugar-free fermentation method and fermentation cycle management provided FLJ with the potential to regulate blood lipids. Further research and verification will be carried out to isolate specific substances from the FLJ and identify their mechanisms of action.

Our image recognition system mainly judges whether the left upper limb in the image is the left upper limb or the right upper limb through our deep learning model in the image. The doctor then could give the correct surgical position. From the experimental results, it could be found that the precision rate and recall rate of the intelligent image recognition system proposed in this paper for preventing the upper limb dislocation surgery could reach 98% and 93%, respectively. It proved that our artificial intelligent image recognition system, AIIRS, could indeed assist orthopedic surgeons to prevent the occurrence of left and right dislocation in upper limb surgery. At the same time, this paper also completes the IRB application approval through the prototype experimental results and will conduct the second phase of human trials in the future. It showed that the research results of this paper will be of great benefit and research value to upper limb orthopedic surgery.

Our image recognition system mainly judges whether the left upper limb in the image is the left upper limb or the right upper limb through our deep learning model in the image. The doctor then could give the correct surgical position. From the experimental results, it could be found that the precision rate and recall rate of the intelligent image recognition system proposed in this paper for preventing the upper limb dislocation surgery could reach 98% and 93%, respectively. It proved that our intelligent image recognition system could indeed assist orthopedic surgeons to prevent the occurrence of left and right dislocation in upper limb surgery. At the same time, this paper also completes the IRB application approval through the prototype experimental results and will conduct the second phase of human trials in the future. It showed that the research results of this paper will be of great benefit and research value to upper limb orthopedic surgery.

Empirical and theoretical advances in human neuroscience have led to a reappraisal of the relationships between mind, brain and body, the implications of which are particularly relevant to understanding emotions, which is revealed to be embodied owing to the facts that they are on the one hand primarily arise from the internal bodily states controlled by interoceptive system, on the other they give rise to physiological reactions and physical action evoked by autonomic nervous system. More specifically, when considering the ‘embodied mind’ (i.e., how mental processes are inescapably contextualized by their location within the body), the brain, instead of the ‘master’ of the body, is increasingly revealed to function as the ‘servant’, with its primary goal to maintain the body’s homeostatic integrity. This is achieved through the control of interoceptive information concerning body’s physiological state, initially as ‘simple’ organ-level homeostatic reflexes and then through higher-order coordination across organ-systems allowing ‘allostatic policies’ to predict and maintain future health of the integrated whole ‘biological-self’. In this context, motivational and emotional feelings arise from interoceptive signals that accompany (motivational and emotional) internally-directed physiological responses, and externally-directed behaviors. Emotion concepts are thus the categorized embodied outcomes of bidirectional brain-body interactions and may arguably be differentiated into afferent interoceptive processes, i.e., from body to brain, and efferent/autonomic processes, i.e., from brain to body. When comparing emotion words used in Chinese and English languages, afferent/interoceptive processes seem to dominate conceptualization of embodied emotions in Chinese, while the efferent processes feature more commonly in English. The presence of distinct conceptual systems relating to emotions may, according to the linguistic relativity hypothesis as well as the theory of constructed emotion, significantly shape the distinct values and ‘national character’ of Chinese and English–speaking cultures. Correspondingly, it is argued that, in the expression of affective traits, Chinese-speaking people are biased towards being more receptive, reflective and adaptive, whereas native English speakers may tend to be more reactive, proactive and interactive. These patterns also encompass functions historically ascribed to bodily organs by traditional Chinese and ancient Greek medicine.

Facilitating sustainable cooperation between schools and enterprises has become an important concern in many countries. However, there remains a gap in understanding the approaches taken by central and local governments to foster such cooperation through the lens of evolutionary game theory. Therefore, this paper aims to develop a quadrilateral evolutionary game model involving schools, enterprises, the central government, and local governments, to analyze the conditions under which governments can effectively promote school-enterprise cooperation. Our findings indicate that benefit is a decisive factor that affects the strategies of all parties. When the benefits of cooperation are sufficiently attractive, schools and enterprises are inclined to cooperate with each other independently of governmental intervention. While increasing incentives and penalties from the central government and local governments can stimulate school-enterprise cooperation, these measures are not sustainable in the long term. Additionally, the impact of the central government’s incentives and penalties on local governments in promoting school-enterprise cooperation is limited. Enhancing policy efficacy and the practical outcomes of school-enterprise cooperation is essential, which not only strengthens the bond between schools and enterprises but also ensures deep and enduring governmental involvement.

Accurate evaluation of health status of lithium-ion batteries must be deemed as of great significance, insofar as utility and safety of batteries are of concern. Lithium plating, in particular, is notoriously known to be a chemical reaction that can cause deterioration in, or even fatal hazards to, the health of lithium-ion batteries. Electrochemical impedance spectroscopy (EIS), which has distinct advantages such as fast or non-destructive over its competitors, suffices in detecting lithium plating and thus has been attracting increasing attention in the field of battery management, but its ability of assessing quantitatively the degree of lithium plating remains largely unexplored hitherto. On this point, this work seeks to narrow that gap, by proposing an EIS-based method that can quantify the degree of lithium plating. The core conception is to eventually circumvent the reliance on state-of-health measurement, and use instead the impedance spectrum, to acquire an estimate on battery capacity loss. To do so, the effects of solid electrolyte interphase formation and lithium plating on battery capacity must be first decoupled, so that the mass of lithium plating can be quantified. Then, based on an impedance spectrum measurement, the parameters of the fractional equivalent circuit model (ECM) of the battery can be identified. These fractional ECM parameters are received as inputs by an artificial neural network, which is tasked to establish a correspondence between the model parameters and the mass of lithium plating. The empirical part of the work revolves around the data collected from an aging experiment, and the validity of the proposed method is truthfully attested by dismantling the batteries, which is otherwise not needed during the actual uptake of the method.

Neuronal cells are believed to rely on autophagy to maintain cellular homeostasis. Nevertheless, autophagy may be a therapeutic target for neurodegenerative diseases because of the role it plays in neuronal cell death. Despite Beclin 1 association with autophagy and apoptosis, the molecular mechanisms that underlie Tau-induced vesicular pathology and Tau protein aggregates in humans remain poorly understood. Here, we set out to examine the role of three genes-ATG14L, Beclin 1 and VPS34- in autophagy nucleation failure-associated Tau disorders in fruit fly models. We found that either reduced ATG14L levels improve neuronal outcomes, or transgenic expression of ATG6/Beclin 1 greatly reduced age-dependent neurodegeneration and Tau pathology; whereas, the loss of Beclin 1 exacerbated these effects. Prior to p-Tau accumulation, the neuronal Beclin 1 network is critical for reducing p-Tau accumulation, indicating that the loss of Beclin 1 causes Tau pathology and neurodegeneration. As neurodegeneration progressed, glial cells showed an upregulation of vesicular Beclin 1 immunoreactivities. The reduced VPS34 also resulted in p-Tau accumulation, suggesting that neurons require both Beclin 1 and VPS34 to reduce p-Tau accumulation. Our results provide mechanistic insight into the molecular pathways that cause age-dependent Tau pathology and neurodegeneration due to an excess of autophagy nucleation processes and autophagy activity, and we derive novel inferences on the therapeutic possibilities of rebalanced Beclin 1 network by reducing autophagic specific nucleation component of ATG14L.

The development of one technology can be portrayed by common methods like Gartner’s hype cycle or S-curve, however, there is no method to characterize the feature distributions of multiple technologies within a specific domain. This study proposes a big data-based method in terms of four proposed features, namely versatility, significance, commerciality, and disruptiveness, to characterize the technologies within a given domain. The features of technologies are quantitively portrayed using the representative keywords and volumes of returned search results from Google and Google Scholar in two-dimensional analytical spaces of technique and application. We demonstrate the applicability of this method using 452 technologies in the domain of intelligent robotics. The results of our assessment indicate that the versatility values are normally distributed, while the values of significance, commerciality, and disruptiveness follow power-law distributions, in which few technologies possess higher feature values. We also show that significant technologies are more likely to be commercialized or causing potential disruption, as such technologies have higher scores in these features. Further, we validly prove the robustness of our approach via comparing historical trends with literature and characterizing technologies in reduced analytical spaces. Our method can be widely applied in analyzing feature distributions of technologies in different domains, and it can potentially be exploited in decisions like investment, trade, and science policy.

Introduction: Treating elbow fracture-dislocation is a challenge, especially in the situation of basal-coronoid trans-ulnar fracture. The study ams to explain whether or not the minimal invasive surgery (MIS) would be feasible in elbow dislocation with coronoid fracture. Materials & Methods: At Taipei Veterans General Hospital, patients who had elbow dislocations with coronoid process fractures underwent single one surgeon’s MIS techniques which included the fluoroscopy-guided ulnar anteromedial (FGUAM) approach in the stage of reducing coronoid process. When there is a proximal ulnar fracture, the posterior incision should be necessary, followed by the incision over the lateral or medial elbow in treating radial fractures or ligament injuries. Results: The Flow Diagram about approach recommendation was established in base of defining MIS as not to do cross-plane dissection. Anteriorly rigid fixation for the coronoid process was also emphasized. Conclusions: MIS can be achieved by multiple limited surgical incisions. However, if there is an unstable ulnar metaphysis or ligament avulsion fracture, the posterior approach has to be extended and the so-called MIS fails to be established.

This study investigated the inhibitory effect of Siegesbeckia orientalis ethanolic extract (SOE) on growth and metastasis of hepatic tumors in C57BL/6JNarl mice, which is the model of tumor-igenesis induced by subcutaneous injection of Hepa1-6 murine hepatoma cells on the back of mice. Feeding 25 mg SOE/kg BW daily for 14 days effectively reduced the hepatoma weight in tu-mor-bearing mice by 59.7%. SOE intervention reduced the expression of anti-apoptotic Bcl-2 gene in tumor tissue by 48.5% and down-regulated the antioxidant system, by reducing the gene ex-pression of catalase (48.0%), glutathione peroxidase (46.3%), and superoxide dismutase (32.0%). In addition, SOE intervention increased the production of ROS by 21.4%, and the gene expression of pro-inflammatory cytokines TNF-α, IL-1β, and IL-6 by 135.3%, 179.3% and 91.7%, respectively, indicating that SOE intervention promoted the acute inflammatory response. Results of H&E staining analysis showed that SOE had the ability to inhibit angiogenesis in tumor tissue. Fur-thermore, SOE treatment inhibited the expression of migration-related genes, such as MMP-2, MMP-7, MMP-9 and β-catenin, and the inhibition rates were 24.8%, 27.4%, 10.4% and 21.9%, respectively. These results imply that SOE had the ability to suppress tumor metastasis. On the other hand, SOE intervention decreased the serum contents of inflammatory cytokines, such as TNF-α, IL-1β and IL-6 by 27.4%, 30.4%, and 30.7%, respectively, indicating that SOE intervention has an anti-inflammatory effect on normal tissues of mice. Since SOE intervention had no signif-icant effect on liver and kidney weights, and no mice died throughout the experiment, it shows that it is safe to feed SOE under this experimental condition. Based on the above results, SOE has a great potential to be used in the treatment of hepatoma.

A method of direction-of-arrival (DoA) estimation for FMCW radars is presented. In addition to MUSIC and ESPRIT, which are well-known high-resolution DoA estimation algorithms, deep learning has recently emerged as a very promising alternative. It is proposed in this paper to use a 3D convolutional neural network (CNN) for DoA estimation. The 3D-CNN extracts from the radar data cube spectrum features of the region of interest (RoI) centered on the potential positions of the targets, thereby capturing the spectrum phase shift information, which corresponds to DoA, along the antenna axis. Finally, the results of simulations and field experiments are provided to demonstrate the superior performance, as well as the limitations, of the proposed 3D-CNN.

Few studies have paid attention to the industrial lands along the Chinese Grand Canal from a cultural per-spective, but cities along the route like Hangzhou have relied on the Canal system to promote industrializa-tion over the past hundred years, and relocated, transformed, or demolished the factories to construct cul-tural space or products mostly after industrial recession at the beginning of 21st century. To deeply analyze this process is quite helpful to understand the typical cultural change and its gain and loss along the Canal especially after cultural and creative industries have been established as the pillar industries of China's na-tional economy. Therefore, along the Hangzhou section of the Canal, we dynamically monitored the land use of the selected 10 industrial lands, with the analysis of high-resolution satellite imageries and the in-dustrial past, the areas of different uses in 2022 were compared. Meanwhile, along with archival data, fieldwork, and experts’ consultation, we designed a mark sheet with factors and scores to comprehensively assess cultural changes over those lands, and its reasons and influence also have been argued, and the prob-lems and suggestions have been offered. This study can contribute to a better understanding of public poli-cy choices in China regarding cities along the Grand Canal after the industrial decline, and provide new perspectives for cultural research, heritage conservation, and urban planning of canals or waterfront spaces.

Here, we present a series of novel block copolymers (BCP) from bio-derived monomers, poly(lactic acid)-block-poly(2,5-furandimethylene succinate) (PLA-b-PFS), in which the furan groups from PFS block can be crosslinked with bis(maleimido) triethylene glycol (M2) through a Diels-Alder reaction. This dynamic crosslinking reaction leads to a network structure for enhancing the mechanical properties compared to their linear BCP analogous. Decreasing the crosslinking density leads to a decrease of glass transition temperature of BCPs and a transition from glassy to rubbery-like behavior at room temperature. This allows a wide tunablity of both elastic moduli and yields of the materials. For the lowest crosslinking density. the material exhibits an over 50% self-healing efficiency at room temperature after five days, attributed to the low Tg (15.2 C) from the introduction of PFS block, allowing sufficient chain mobility for structure re-organization. Moreover, with the appropriate selection of crosslinking density (PLA-b-PFS/M2 (6/1)), it also shows an excellent shape memory property with a high recovery rate of 96.3% and a fixity rate of 97.3%. The permanent shape can be rewriteable due to the reversibility of Diels-Alder reaction. With these advanced functionalities and ease in large-scale fabrication, the PLA-b-PFS/M2 shows great promises for self-healing coatings or films with shape memory properties in a wide variety of applications such as packaging materials

When analyzing user geospatial information through deep learning methods, it is typically necessary to annotate existing geospatial data. Currently, manual annotation methods are commonly employed, suffering from issues related to low efficiency and accuracy. This design is based on the TensorFlow deep learning framework and first realizes the BiLSTM+CRF+AGG deep learning model. Among the models, AGG is the aggregation layer, which is introduced to solve the problem of solid particle size equilibrium. Secondly, based on the characteristics of original data and professional data, an automatic labeling algorithm is proposed. The algorithm first preprocesses the acquired original data set and professional data set, The most valuable unlabeled data set which can make the training model converge quickly is selected from the original data set as the target data set. Sort the target data set based on preset rules and set annotation parameters for the sorted target data set. Based on the set annotation parameters, the corpus is synthesized and used as the annotation result. Thirdly, based on the active learning strategy, a manual annotation auxiliary scheme is proposed, and an Excel generation module that is convenient for manual annotation correction is designed and developed to further improve the efficiency and quality of annotation through iterative processing. The combination of the BiLSTM+CRF+AGG deep learning model and high-quality annotation can accurately identify non-standard, incomplete, or even incorrect geographical information entities. This annotation method has found successful practical application within the context of the research project and has been granted an invention patent.

In this work we discuss the numerical challenges involved in the computation of the complex eigenvalues of damped multi-flexible-body problems. Aiming at the highest generality, the candidate method must be able to deal with arbitrary rigid body modes (free-free mechanisms), arbitrary algebraic constraints, and must be able to exploit the sparsity pattern of Jacobians of large systems. We propose a custom implementation of the Krylov-Schur method, proving its robustness and its accuracy in a variety of different complex test cases.

Hydroa vacciniforme (HV) is a rare form of photosensitivity disorders in children and is frequently associated with Epstein-Barr virus (EBV) infection, whereas HV-like lymphoproliferative disorders (HVLPD) describe a spectrum of EBV-associated T-cell or NK-cell lymphoproliferations with HV-like cutaneous manifestations, including EBV-positive HV, atypical HV, and HV-like lymphoma. Classic HV occurs in childhood with vesiculopapules on sun-exposed areas, which is usually induced by sunlight and ultraviolet irradiation, and mostly resolves by early adult life. Unlike classic HV, atypical or severe HV manifests itself as recurrent papulovesicular eruptions in sun-exposed and sun-protected areas associated occasionally with facial edema, fever, lymphadenopathy, oculomucosal lesions, gastrointestinal involvement, and hepatosplenomegaly. Notably, atypical or severe HV may progress to EBV-associated systemic T-cell or natural killer (NK)-cell lymphoma after a chronic course. Although rare in the United States and Europe, atypical or severe HV and HV-like lymphoma are predominantly reported in children from Asia and Latin America with high EBV DNA levels, low numbers of NK cells, and T cell clones in the blood. In comparison with the conservative treatment used for patients with classic HV, systemic therapy such as immunomodulatory therapy is recommended as the first-line therapy for patients with atypical or severe HV. This review aims to provide an integrated, overview of current evidence and knowledge of HV and HVLPD to elucidate the pathophysiology, practical issues, environmental factors, and the impact of EBV infection.

Diastolic dysfunction, a prevalent condition characterized by impaired relaxation and filling of the left ventricle, significantly contributes to heart failure with preserved ejection fraction (HFpEF). Galectin-3, a β-galactoside-binding lectin, has garnered attention as a potential biomarker and mediator of fibrosis and inflammation in cardiovascular diseases. This comprehensive review investigates the impact of galectin-3 on diastolic dysfunction. We explore its molecular mechanisms, including its involvement in cellular signaling pathways and interaction with components of the extracellular matrix. Evidence from both animal models and clinical studies elucidates galectin-3's role in cardiac remodeling, inflammation, and fibrosis, shedding light on the underlying pathophysiology of diastolic dysfunction. Additionally, we examine the diagnostic and therapeutic implications of galectin-3 in diastolic dysfunction, emphasizing its potential as both a biomarker and a therapeutic target. This review underscores the significance of comprehending galectin-3's role in diastolic dysfunction and its promise in enhancing diagnosis and treatment approaches for HFpEF patients.

Cisplatin-based chemotherapy has long been viewed as the first-line chemotherapy for advanced and metastatic urothelial carcinoma (UC). However, many patients with UC have been classified as “cisplatin-ineligible patient”, which requires alternative chemotherapy due to their poor responses. In fact, vast majority of those who initially responded to cisplatin-based chemotherapy eventually progressed. Understanding of UC tumor immunology provided an immunopathogenic bases for immune checkpoint inhibitors, targeting PD-1 and CTLA-4, to treat cisplatin ineligible metastatic UC and patients with platinum-refractory metastatic UC. In 2020, data from the trail further showed that PD-L1 inhibitors benefit prolonged survival and progression-free survival as maintenance therapy. Besides immune-targeting therapies, manipulation of tumor microenvironment via metabolic pathways alternation, such as inhibiting tumor glycolysis, lactate accumulation and exogenous glutamine uptake, has been investigated in the past few years. In this comprehensive review, we started by introducing traditional chemotherapy of UC, and summarized current evidences supporting the use of immune checkpoint inhibitors and highlighted ongoing clinical trials. Lastly, we reviewed the tumor metabolic characteristic and the anti-tumor treatments targeting metabolic pathways.

Railway has been used as one of the most crucial means of transportation in public mobility and economic development. For efficiently operating railways, the electrification system in railway infrastructure, which supplies electric power to trains, is essential facilities for stable train operation. Due to its important role, the electrification system needs to be rigorously and regularly inspected and managed. This paper presents a supervised learning method to classify Mobile Laser Scanning (MLS) data into ten target classes representing overhead wires, movable brackets and poles, which are recognized key objects in the electrification system. In general, the layout of railway electrification system shows a strong regularity of spatial relations among object classes. The proposed classifier is developed based on Conditional Random Field (CRF), which characterizes not only labeling homogeneity at short range, but also the layout compatibility between different object classes at long range in the probabilistic graphical model. This multi-range CRF model consists of a unary term and three pairwise contextual terms. In order to gain computational efficiency, MLS point clouds is converted into a set of line segments where the labeling process is applied. Support Vector Machine (SVM) is used as a local classifier considering only node features for producing the unary potentials of CRF model. As the short-range pairwise contextual term, Potts model is applied to enforce a local smoothness in short-range graph. While, long-range pairwise potentials are designed to enhance spatial regularities of both horizontal and vertical layouts among railway objects. We formulate two long-range pairwise potentials as the log posterior probability obtained by Naïve Bayes classifier. The directional layout compatibilities are characterized in probability look-up tables which represent co-occurrence rate of spatial relations in horizontal and vertical directions. The likelihood function is formulated by multivariate Gaussian distributions. In the proposed multi-range CRF model, the weight parameters to balance four sub-terms are estimated by applying the Stochastic Gradient Descent (SGD). The results show that the proposed multi-range CRF can effectively classify detailed railway elements, representing the average recall of 97.66% and the average precision of 97.07% for all classes.

The location routing problem of unmanned aerial vehicles (UAV) in border patrol for intelligence, surveillance and reconnaissance is investigated, where the location of UAV base stations and the UAV flying routes for visiting the targets in border area are jointly optimized. The capacity of the base station and the endurance of the UAV are considered. A binary integer programming model is developed to formulate the problem, and two heuristic algorithms combined with local search strategies are designed for solving the problem. The experiment design for simulating the distribution of stations and targets in border is proposed for generating random test instances. Also, an example based on the Sino-Vietnamese border is presented to illustrate the problem and the solution approach. The performance of the two algorithms are analyzed and compared through randomly generated instances.

CO2 has characteristic properties and reactions at converter smelting temperature, and the chemical reaction between CO2 and elements such as C and Si in the molten pool has bubble proliferation and cooling effects, which can effectively improve the kinetic and thermodynamic conditions of converter smelting. Here, an experimental study and industrial test on the application of CO2 in converter smelting were carried out. The smelting effects of Mode-1 and Mode-2 with total CO₂ injection amounts of 229 Nm³ and 196 Nm³, respectively, were compared, and the changes in molten steel and slag compositions, dust removal, and gas are analyzed. The test results show that converter top and bottom blowing CO₂ technology (COMI-B)technology had significant metallurgical advantages over the N-Mode; the dephosphorization rate increased by 4.2%, slag (FeO) content was reduced by 2.04%, end point nitrogen content of molten steel was reduced by 20%, gas recovery increased by 8.29 Nm³/t, and soot production reduced by 14.7%. The results of the study provide reference for the application of COMI-B technology in converters in the iron and steel industry and develop a new path for resource utilization of CO₂.

The COVID-19 pandemic halted progress in global vaccine coverage and disrupted routine childhood vaccination practices worldwide. While there is ample evidence of vaccination declines experienced during the pandemic, it is less clear how low-income countries were affected. We executed a systematic review to synthesize the current literature on impacts to routine childhood vaccinations in low-income countries from January 1, 2020 to February 8, 2023. We collected data using an extraction form on Covidence and assessed the quality of studies included in the review using the Risk of Bias in Non-Randomized Studies of Interventions (ROBINS-I) tool. Effect estimates for changes in vaccination during the pandemic were reported and summarized. Factors that influenced changes were grouped into descriptive themes. Thirteen studies, encompassing 18 low-income countries and evaluating 15 vaccines at varying doses, were included in the final review. We found that routine childhood vaccinations during the COVID-19 pandemic varied considerably by vaccine type, location, and phase of the pandemic. Nine different themes were identified as factors that influenced changes in vaccination. Documenting past experiences and lessons learned is crucial for informing preparedness efforts in anticipation of future public health emergencies. Failure to effectively address these things in the next public health emergency could result in a recurrence of declining routine childhood vaccinations.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

At present more than 9 million people die of cancer every year. Simple and broad-spectrum drugs are still an urgent need for cancer patients. Recently, we proposed a new hypothesis that intracellular osmotic pressure (IOP) is the driving force of cell division, and abnormal tumor proliferation is the result of uncontrolled IOP in cells. On the one hand, aneuploidy and abnormal function of Na⁺/K⁺ pump lead to a faster rise of IOP in tumor cell than normal cells, on the other hand, abnormality of cytoskeleton assembly leads to the decrease of tolerance limit of cell membrane (TLCM) of tumor cells for resisting IOP. This hypothesis predicts: 1)Tumor cells were more intolerant to hypotonic stress than normal cells. 2) Maligancies may be sellectively killed by a suddenn increase of IOP and combined with decrease of the TLCM of tumors. Na⁺/K⁺ pump inhibitors can promotely increase the IOP of tumor cells and cytoskeleton inhibitors can dramatically lower the TLCM of tumor cells. Therefore, Na⁺/K⁺ pump and cytoskeleton inhibitors may have a synergetic effect to kill tumor cells. 3) Molecules regulating cell osmolality may be new targets for cancer treatment.

Chromatographic separation is a critical technique in the manufacturing processes of both chemical products and biopharmaceuticals. Its principle relies on exploiting the differences in distribution between the stationary and mobile phases to achieve the separation of mixtures. The precision of substance concentration during separation directly impacts the quality and usability of the final product. Therefore, the development of an effective and precise separation control technique has long been a vital concern in the field of chromatographic separation control. Currently, the employment of Simulated Moving Bed (SMB) technology for chromatographic separation, which allows for continuous feed, has been recognized as a cutting-edge technique. SMB is a continuous process technology that enhances the efficiency of adsorbents within the bed. This sequential multi-column SMB technology not only increases production capacity but also reduces the consumption of solvents and water. It is acknowledged as one of the cleanest manufacturing technologies in the biopharmaceutical industry. However, multi-column SMB involves various variables such as flow rates in multiple sections and valve switching times, rendering its system control highly complex. Unlike traditional control objectives that aim to minimize control output errors, the control objective of SMB is to achieve a specific proportion of substance concentration. Consequently, designing and implementing traditional control theories for SMB is challenging, leading to SMB systems largely being controlled based on simple PLC controls. Moreover, these controls are often applicable only to single or a few-column SMB setups, limiting the effectiveness of high-capacity applications. To achieve effective control of SMB, this study employs an adjustable intelligent fuzzy controller with a structure like an approximate neural network (NN) for SMB control research. Simulation results demonstrate that the intelligent controller effectively achieves desirable control outcomes for the SMB system.

Aiming at the problems of high labor intensity and high cost of manual picking, high loss rate of mechanical picking seeds, low mechanization level and difficult to guarantee the quality of picking plates in the process of picking plates of edible sunflower. Based on the principle of manual plate taking, a plate taking control system for sunflower harvesting table was designed. Through the research and analysis of the principle of taking the plate of the edible sunflower harvesting table. According to the actual operation requirements, the overall scheme of the sunflower plate control system is determined, and the control strategy of imitating artificial low loss harvesting is designed. To reduce the grain loss in the process of taking the plate and improve the control accuracy of the system on the movement speed and displacement of the key components in the process of taking the plate, a trapezoidal acceleration and deceleration control algorithm is designed as the control algorithm of taking the plate. To verify the working performance of the plate control system, with the absolute error, relative error and total loss rate of the harvest as objectives. The bench and field verification experiments were both carried out. The bench experiment showed that the speed error of the plate parts was not more than 0.028 m/s. In the bench experiments of the device, the maximum positioning error was 1.25 mm, the average relative error is only 0.94 %, and the grain loss rate was not more than 2.26 %. It result showed that the system algorithm was reliable, the positioning accuracy was high, and the taking plate operation can be completed well. The field verification experiment showed that the forward speed of the unit was in the range of 0.4~0.8 m/s, and the total loss rate of harvest was less than 5 %. When the forward speed is 0.6 m/s, the minimum harvest loss rate is 2.32 %, and which indicated the control system meets the requirements of sunflower harvesting operation.

The effect of Al or Cu content on the microstructure and mechanical properties of continuous casting and extrusion Zn alloys has been studied by room temperature tensile test, X-ray diffraction, and scanning electron microscope. With the increase of Al content, the microstructure of continuous casting and extrusion Zn alloys slightly coarsens and the lamellar eutectic structure increases. The changes in the above structural factors result in a slight decrease in strength and a significant increase in elongation of Zn-Al alloys. The strength of Zn alloys increases as the Cu content increases, due to the increased content and size of the second phase in the Zn alloys. This means that the mechanical properties of Zn alloys can be adjusted by continuous casting and extrusion process, and the improvement of equipment capacity can improve the structure and morphology of the alloys.

In this paper, the research progress on dynamic behaviors of RC structural members is reviewed from experimental, theoretical and numerical perspectives. Firstly, the basic overview, measurement methods, main conclusions and current limitations of available dynamic loading tests are presented. Then the theoretical studies on the dynamic constitutive models of RC materials, the dynamic increase factor (DIF) model for concrete and reinforcing steel and the proposed modified models of dynamic behavior parameter at the structural member level are summarized. Finally, the available modelling approach and the method for incorporating the dynamic effect in numerical simulation of RC structures are reviewed. Moreover, a brief introduction is made to the dynamic hysteretic model established on the experimental data, which provides an alternative approach to consider the dynamic effect beside the commonly used DIF method. This paper provides valuable reference for experimental studies and numerical simulations on the dynamic behaviors of RC structures, and also puts forward some issues that need to be solved in the future research works..

Blood testing is a crucial medical application. In this study, we applied Raman spectroscopy to test blood samples and obtained complete biological information, including the main components and compositions in these samples. Short-wavelength (532-nm green light) Raman scattering spectroscopy was conducted on samples of normal blood, abnormal blood in 3 types of preparation including whole blood, plasma, and serum, and the underlying information reflected by the biological characteristics detected in each sample type were analyzed. Raman spectroscopy results indicated that normal blood had high hemoglobin content, which suggests that hemoglobin is a major component of blood. Hemoglobin affects blood oxygen level. The characteristic peaks of hemoglobin were observed at 690, 989, 1015, 1182, 1233, 1315, and 1562–1649 cm−1. Analysis of plasma and serum samples indicated the presence of β-carotene, which exhibited characteristic peaks at 1013, 1172, and 1526 cm−1. In addition, surface-enhanced Raman spectroscopy was used to collect biological signals that are difficult to obtain in conventional Raman spectroscopy, including those of small molecules such as hormones, antibodies, and enzymes. Changes in biological information collected in this manner can be used as a basis for potentially diagnosing clinical diseases.

Background: The main factors to influence on the stroking performance of club head are alloy and spring-like effect. Design the structure of new club face to create the fairway wood which can show best stroking feeling and let driving distance become longer. Purpose: The club face of fairway wood is processed through the iron alloy heating procedure and CNC to innovate the club head with high spring-like effect (characteristic time). Method: (1) Use 455 stainless steel processed by heating and aging treatment, to do the analysis on microstructure and mechanical properties. (2) Through CNC to design seven different patterns for the back of club face, each pattern for three club head. The total amount is twenty-one. (3) Make finished product be test the characteristic time and the ability of strike by the practical measurement. (4) To analyze after the compare between three-way ANOVA and LSD. Results: After 455 stainless steel was heated in procedure S850℃-A550℃, mechanical properties became superior and had the better malleability, it is suitable for developing the club face of high spring-like effect. Before and after grinding among three-way ANOVA (pattern*thickness*place), did not achieve the significant level on the figure of characteristic time. Through two-way ANOVA (pattern*place and thickness*place), showed the significant deviation before and after grinding. After doing the crash test by 45m/s, all the results can reach the higher limited standard. Summary: 455 stainless steel was designed with the different club face’s thicknesses of fairway wood can make spring-like effect achieve high characteristic time. The much thinner club face let the characteristic time perform highly. But there was no obvious effects from the patterns of the back club face.

The small intestinal villus is covered with a thick layer of mucus that is secreted by goblet cells and functions primarily to first barrier from damage by toxic substance. Recent studies showed that goblet cells and mucins involved in complex immune function. Lipopolysaccharide (LPS) is widespread in the housing of livestock, which can induce bacterial infection symptoms and immunological stress within a short of time. Therefore, we aimed to study the effects of long-term exposure to different doses of LPS on intestinal mucus layer and immune barrier. The result showed that mucus layer thickness and goblet cell functions were significantly increased after low doses of LPS. The intestinal mucosal barrier can block the bacteria of the lumen, but LPS can penetrate this barrier into the blood, putting the body in a state of chronic low-grade inflammation and reducing the body’s immune function. However, after long-term exposure to high doses of LPS, a large number of lysosomes in goblet cells caused loss of function, and mucus layer thickness was significantly decreased. A large amount of LPS stuck to the mucus, leading to normal LPS and inflammatory cytokines level of plasma. The intestinal tissue morphology was damaged, and a number of immune cells were necrosis in the intestine. Collectively, long-term exposure to low doses of LPS lead to chronic low-grade inflammation in the body. Long-term exposure to high doses of LPS can be directly linked to the severity of the immunosuppression in the body.

This paper aims to present a smart high speed battery charger, powered by a photovoltaic module array, for a LiFePO4 battery as a solar energy storage device. With a battery charging strategy, the presented battery charger involves a Buck converter as the core equipped with a simple maximum power point (MPP) tracker. Considering complexity reduction and easy hardware implementation, a constant voltage MPP tracking approach is adopted such that the maximum amount of output power can be delivered to the load in response to an arbitrary change in the solar radiation. A smart two-stage charging strategy, with a constant current mode followed by a constant voltage mode, is employed in such a way that the battery charge process can be accelerated largely, while the damage caused by overcharging can be prevented. In the end, the performance of this proposal is validated experimentally.

This research seeks to advance the understanding of ecological management in the Huaihe River Basin, China. The spatiotemporal variability of the Normalized Difference Vegetation Index (NDVI) and its underlying driving forces are examined utilizing SPOT-NDVI data covering the period 2000-2019. Linear regression analysis is employed to quantify trends and assess the statistical significance of NDVI variations. A differencing approach is subsequently applied to discern the variability in NDVI. The distribution of its spatial pattern stability over 20 years is explored through the coefficient of variation. Lastly, the Geodetector method is utilized to elucidate the driving factors influencing NDVI dynamics. The results indicate that the overall NDVI is generally high, with an overall growth rate of 0.00148/year, and 2010 is identified as a significant inflection point in the trend. NDVI values are notably lower in urban areas, corresponding to urban expansion, except for regions near rivers and lakes. Land use type emerges as the strongest explanatory factor for NDVI among single factors, with climate factors exhibiting a relatively weaker degree of explanatory force. These findings suggest that the overall NDVI in the Huaihe River Basin is high, indicative of a vegetation condition that continues to improve.

Cs2NaInCl6 double perovskites, which have excellent photoelectric conversion properties and are non-toxic and lead-free, have recently attracted much attention. In particular, double perovskite quantum dots (QDs) are considered to be a promising material for optoelectronic device applications. Ligands such as oleic acid (OA) and oleylamine (OAm) are essential for the synthesis of perovskite QDs, but their roles on double perovskite QDs are not yet clear. In this study, we have investigated the binding of OA and OAm to Cs2NaInCl6 QDs through FTIR and NMR and their effects on the surface defect reduction and stability improvement for Cs2NaInCl6 QDs. We found that only OAm was bound to the QD surfaces while OA was not. The OAm has a great effect on photoluminescence quantum yield (PLQY) improvement by passivate the QD surface defects. The stability of the QDs was also investigated, and it was shown that OA played a significant role in the stability of the QDs. Our findings provide critical insights into the roles of the ligands for photophysical properties and stability of lead-free double perovskite QDs.

Luminescent properties of epitaxial Cu2O thin films were studied in 10-300 K temperature range and compared with luminescent properties of Cu2O single crystals. Cu2O thin films were deposited epitaxially by the electrodeposition method on either Cu or Ag substrates at different processing parameters, which determined the epitaxial orientation relationships and encapsulated surface. Cu2O (100) and (111) single crystal samples were cut from a crystal rod grown by the floating zone method. Luminescence spectra of thin films contain the same emission bands as single crystals around 720, 810 and 910 nm, characterizing VO2+, VO+ and VCu defects, correspondingly. Additional emission bands, whose origin is under discussion, are observed around 650-680 nm, while the exciton features are negligibly small. The relative mutual contribution of the emission bands varies depending on the particular thin film sample. Existence of the domains of crystallites with different orientation determines the polarization of luminescence. PL of both Cu2O thin films and single crystals is characterized with negative thermal quenching in the low temperature region, the reason of this phenomenon is discussed.