The adaptive identification method developed to evaluate the parameters of the Bouc-Wen hysteresis (BWH). The adaptive approach based on the use of adaptive observers. We synthesize adaptive identification algorithms using the second Lyapunov method. The boundedness of adaptive system processes shown in coordinate and parametric spaces. We prove exponential dissipativity of processes in an adaptive system. Estimating method proposed for signaling uncertainty in the system.

Pancreatitis and alcoholic pancreatitis are serious health concerns, and there is an urgent need for effective treatment strategies. Alcohol is a known etiological factor for pancreatitis, including acute pancreatitis (AP) and chronic pancreatitis (CP). Excessive alcohol consumption induces many pathological stress responses; of particular note is endoplasmic reticulum (ER) stress and adaptive unfolded protein response (UPR). ER stress results from the accumulation of unfolded/misfolded protein in the ER and is implicated in the pathogenesis of alcoholic pancreatitis. Here we summarize the possible mechanisms by which ER stress contributes to alcoholic pancreatitis. We also discuss potential approaches targeting ER stress and UPR for developing novel therapeutic strategies for the disease.

We explored the trends and the diversity of the mortality and risk factors of age-standardized cardiovascular diseases (CVD) and cerebrovascular disease (CBD) from 2000 to 2020 in five advanced Asian countries, including China, Japan, Singapore, South Korea, and Taiwan. Data were obtained from the Global Burden of Disease (GBD) report. Overall, the CVD mortality rates decreased gradually in all five Asian countries. Singapore had the highest rates before 2011, but Taiwan replaced Singapore as the nation of the highest mortality rates after 2012. Additionally, South Korea had the highest CBD mortality rates before 2016, while Taiwan experienced a peak in 2011 and remained high thereafter. The absolute difference (AD) and relative difference (RD) for CVD mortality rates showed clear declining trends in all five countries, with South Korea and China displaying the highest reductions, respectively. It is noteworthy that overweight and obesity exhibited an increasing trend in all these five Asian countries, with China demonstrating the highest AD and RD. Except for Taiwan, where a negative association of r=-0.732 was observed, CVD mortality was positively associated with CBD, hypertension, and DM mortality in all other four countries, therefore, further investigation into these relationships are needed.

Dry eye syndrome (DES) has become increasingly prevalent due to the prolonged use of digital devices in modern society. Individual supplementation with lutein or docosahexaenoic acid (DHA) demonstrated potential benefits for eye health. This study aimed to investigate the effects of lutein plus DHA complex supplementation on DES, visual function, and memory in healthy individuals. Thirty-four participants, aged 40~60 years, received lutein/DHA complex supplements (containing 10 mg free-form lutein, 200 mg DHA, 30 mg red algae extract (astaxanthin), phosphatidylserine, and vitamin A) for 12 weeks. Ophthalmological examinations and memory tests were carried out, and a questionnaire was administered at weeks 0, 6, and 12 of the study. After 12 weeks of the intervention, the tear break-up time had significantly increased, and intraocular pressure (IOP) had significantly decreased. This suggests that lutein/DHA complex supplementation may reduce the IOP and offer potential benefits for DES, as indicated by improved tear stability.

With the COVID-19 pandemic now ongoing for close to a year, people all over the world are still waiting for a vaccine to become available. The initial focus of accelerated global research and development efforts to bring a vaccine to market as soon as possible was on novel platform technologies that promised speed but had limited history in the clinic. In contrast, recombinant protein vaccines, with numerous examples in the clinic for many years, missed out on the early wave of investments from government and industry. Emerging data are now surfacing suggesting that recombinant protein vaccines indeed might offer an advantage or complement to the nucleic acid or viral vector vaccines that will likely reach the clinic faster. Here, we summarize the current public information on the nature and on the development status of recombinant subunit antigens and adjuvants targeting SARS-CoV-2 infections.

The research fills the policy research gap for the women entrepreneurship and sustainability performance for examining key successful factors. Previous women entrepreneurship research fails to offer policy recommendations. The research purpose is to investigate these factors affect women entrepreneurship capabilities and sustainability performance by using SEM analysis and making policy recommendation. This research employs online and mail survey and obtains 175 women entrepreneur sample. The study finds that family support and motivation have positive effect on women entrepreneurship capabilities and sustainability performance. Barriers have no effect on performance. Hopefully, the research can provide the guidance to contribute to women’s entrepreneurship opportunities for achieving SDGs. Policy recommendation and managerial implication are discussed in the article.

The application of Virtual Reality in a driving simulation is not novel, yet little is known about the use of this technology by senior populations. The effects of age, sex, control device (joystick or handlebar), and task type on wayfinding proficiency using a virtual reality (VR) driving simulation were explored. The driving experimental model involved 96 randomly recruited participants, including 48 young people and 48 seniors (split evenly by gender in each group). The experimental results and statistical analyses indicate that in a VR driving scenario task type significantly affected VR driving performance. Navigational scores were significantly higher for the straight (easy) task than for the curved (difficult) task. The aging effect was the main reason for significant and interacting effects of sex and control device. It was found that interactions between age and sex difference indicated that the young group exhibited better wayfinding performance than the senior group, and in the young group males had better performance than females. Similarly, interactions between age and control device indicated that the handlebar control device type resulted in better performance than the joystick device in the young group, but no difference was found in the senior group due to age or learning effects. Findings provide an understanding of the evaluation of the interface designs of navigational support systems, taking into consideration any effects of age, sex, control device, and task type within three-dimensional VR games and driving systems. With a VR driving simulator, seniors can test drive inaccessible products, such as electric bicycles or cars, using a computer at home.

Technology can be seen everywhere and has been integrated into our lives.We are always using technology and enjoying the convenience brought by technology. However, physical retailers and e-commerce companies are also gradually adopting advanced technologies. Technology improves the purchasing environment and purchasing experience. Virtual reality and augmented reality have been hotly discussed in recent years. Technology, although virtual reality and augmented reality technology have not yet matured, it can be said that they will in the future It has great development potential. Virtual reality and augmented reality are also beginning to sprout in the retail industry. However, research on the acceptance of the use of virtual reality and augmented reality in the apparel shopping process is still lacking because This study explores how usefulness, ease of use, hedonicity, customer experience, customer engagement and satisfaction. To influence customer loyalty, this study adopted questionnaire survey and convenience sampling methods, and collected a total of 308 valid questionnaires. The analysis method used confirmatory factor analysis and structural equation model to verify the research hypothesis relationship. The results of this study found. Hedonic has a significant impact on customer loyalty, while usefulness, ease of use, customer experience, customer engagement and satisfaction Satisfaction does not have a significant impact on customer loyalty. This study explains the academic contribution of the research results. The practical implications in marketing are put forward, and specific suggestions and directions for future research are given.

Bisphenol A (BPA) has been identified as one of endocrine disrupting chemicals (EDCs). Due to its massive production (over 700,000 tons per year) and the extensive use of BPA-based plastics (i.e., polycarbonate and epoxy resin) in Taiwan, it was thus included into a toxic substance by the Ministry of Environment. This work surveyed the updated information about the production of BPA and its environmental distributions in Taiwan over the past decade. Furthermore, the regulatory strategies and countermeasures for managing the environmental risks of BPA by the Taiwan government were summarized to show the cross-ministerial efforts under the relevant acts, including the Toxic and Concerned Chemical Substances Control Act (TCCSCA), the Food Sanitation Management Act (FSMA) and the Commodity Inspection Act (CIA). The findings showed that most of the monitoring data showed far below the acceptable risks. However, the people may pose an adverse threat to the aquatic environment and human health via ecological and food chains. In addition, some countermeasures were further recommended to echo the international actions on environmental endocrine disruptors in recent years.

Autophagy is a highly conserved self-degradation process involving the degradation and recycling of cellular components and organelles. Although the involvement of autophagy in metabolic changes during fruit ripening has been preliminarily demonstrated, the variations in autophagic flux and specific functional roles in fruit ripening remain to be elucidated. In this study, we analyzed the occurrence of autophagy during tomato fruit ripening. The results revealed differential expression of SlATG8 family member during tomato fruit ripening. Transmission electron microscopy observations and dansylcadaverine (MDC) staining confirmed the presence of autophagy at the cellular level in tomato fruits. Furthermore, the overexpression of SlATG8f induced the formation of autophagosomes, increased autophagic flux within tomato fruits, effectively enhanced the expression of ATG8 proteins during the color transition phase of fruit ripening, thereby promoting tomato fruit maturation. This overexpression also led to the accumulation of vitamin C (VC) and soluble solids while reducing acidity in the fruit. Collectively, our findings highlight the pivotal role of SlATG8f in enhancing tomato fruit ripening, providing insights into the mechanistic involvement of autophagy in this process. This research contributes to a better understanding of key factors regulating tomato fruit quality and offers a theoretical basis for tomato variety improvement.

A SARS-CoV receptor-binding domain (RBD) recombinant protein was developed and manufactured under current good manufacturing practices in 2016. The protein known as RBD219-N1 when formulated on Alhydrogel®, induced high-level neutralizing antibodies and protective immunity with minimal immunopathology in mice after a homologous virus challenge with SARS-CoV (MA15 strain). In this report, we examined published evidence in support of whether the SARS-CoV RBD219-N1 could be repurposed as a heterologous vaccine against Coronavirus Infectious Disease (COVID)-19. Our findings include evidence that convalescent serum from SARS-CoV patients can neutralize SARS-CoV-2. Additionally, a review of published studies using monoclonal antibodies (mAbs) raised against SARS-CoV RBD and that neutralize the SARS-CoV virus in vitro, finds that some of these mAbs bind to the receptor-binding motif (RBM) within the RBD, while others bind to domains outside this region within RBD. This information is relevant and supports the possibility of developing a heterologous SARS-CoV RBD vaccine against COVID-19, especially due to the finding that the overall high amino acid similarity (82%) between SARS-CoV and SARS-CoV-2 spike and RBD domains is not reflected in RBM region (59%). However, the high similarity (94%) in the region outside of RBM offers the potential of conserved neutralizing epitopes between both viruses.

Enterovirus 71 (EV71) is an etiological agent of hand foot and mouth disease and can also cause neurological complications in young children. However, there are no approved drugs to treat EV71 infections. In this study, we conducted an antiviral drug screening by using a Food and Drug Administration (FDA)-approved drug library. We identified five drugs that showed dose-dependent inhibition of viral replication. Sertraline was further characterized because it exhibited the most potent antiviral activity with the highest selectivity index among the five hits. The antiviral activity of sertraline was noted for other EV serotypes. The drug’s antiviral effect is not likely associated with its approved indications as an antidepressant and its mode-of-action as a selective serotonin reuptake inhibitor. The time-of-addition assay revealed that sertraline inhibited an EV71 infection at the entry stage. We also showed that sertraline partitioned into acidic compartments, such as endolysosomes, to neutralize the low pH levels. In agreement with the findings, the antiviral effect of sertraline could be relieved greatly by exposing virus-infected cells to extracellular low-pH culture media. Together, we have identified an FDA-approved antidepressant with the new indication for the broad-spectrum EV inhibition by blocking viral entry through the alkalization of the endolysosomal route.

This paper aims to search for lump waves in a spatial symmetric (2+1)-dimensional dispersive wave model. Through an ansatz on positive quadratic functions, we conduct symbolic computations with Maple to generate lump waves for the proposed nonlinear model. A line of critical points of the lump waves is computed, whose two spatial coordinates travel at constant speeds. The corresponding maximum and minimum values are evaluated in terms of the wave numbers, and interestingly, all those extreme values do not change with time, either. The last section is the conclusion.

In GDI engine applications, high-pressure (H.P.) injectors typically require to be designed to be capable of rapid response for GDI engines in order to be driven in the rapid response with respect to magnetic actuators, allowing for example more precise air-fuel ratio control in the GDI engines. The H.P. fuel injector is a highly dynamic component requiring careful voltage and pressure input modulation to achieve the required fuel injection quantities of GDI engines. The accurate fuel injection curves are a key influence for this technology, therefore will require the estimation of the fuel flow rate to be realized. In this paper, a PIC microchip for programming injector drive circuits is implemented to improve the performance of a H.P. fuel injector and tested to verify its feasibility. In the proposed injector drive circuit, powers MOSFETs directly control the charging/discharging current by a dsPIC30F4011 microchip. Design and analysis of the proposed injector drive circuit are presented. Next, effects of total pulse width, injector supply voltage, fuel system pressure and PWM operation on fuel injection quantities of a H.P. fuel injector are measured. Also, the measured data of the H.P. fuel injector fed by the injector driving circuit are defined as the fuel injection curves. Finally experimental results are provided for verification of the proposed injector drive circuit.

Video editing is a high-required job, for it requires skilled artists or workers equipped with plentiful physical strength and multidisciplinary knowledge, such as cinematography, aesthetics. Thus gradually, more and more researches focus on proposing semi-automatical and even fully automatical solutions to reduce workloads. Since those conventional methods are usually designed to follow some simple guidelines, they lack flexibility and capability to learn complex ones. Fortunately, the advances of computer vision and machine learning make up the shortages of traditional approaches and make AI editing feasible. There is no survey to conclude those emerging researches yet. This paper summaries the development history of automatic video editing, and especially the applications of AI in partial and full workflows. We emphasizes video editing and discuss related works from multiple aspects: modality, type of input videos, methology, optimization, dataset, and evaluation metric. Besides, we also summarize the progresses in image editing domain, i.e., style transferring, retargeting, and colorization, and seek for the possibility to transfer those techniques to video domain. Finally, we give a brief conclusion about this survey and explore some open problems.

Continuous research into the availability of phosphorus (P) in forest soil is critical for sustainable management of forest ecosystems. In this study, we used sequential chemical extraction and 31P-nuclear magnetic resonance spectroscopy (31P-NMR) to evaluate the form and distribution of inorganic P (Pi) and organic P (Po) in Casuarina forest soils of a subtropical coastal sand dune at Houlong in Taiwan. The soil samples were collected from humic (+2-0 cm) and mineral layers (mineral-I: 0-10, mineral-II: 10-20 cm) at two topographic locations (upland and lowland) by elevation. Sequential chemical extraction revealed that the NaOH-Po fraction, as moderately recalcitrant P, was the dominant form in humic and mineral-I layers in both upland and lowland soils, whereas the cHCl-Pi fraction was the dominant form in the mineral-II layer. Resistant P content, including NaOH-Pi, HCl-Pi, cHCl-Pi, and cHCl-Po fractions, was higher in the upland than lowland in the corresponding layers; however, labile P content, NaHCO3-Po, showed the opposite pattern. Content of resistant Pi (NaOH-Pi, HCl-Pi, and cHCl-Pi) increased significantly with depth, but that of labile Pi (resin-Pi and NaHCO3-Pi) and recalcitrant Po (NaHCO3-Po, NaOH-Po, and cHCl-Po) decreased significantly with depth at both locations. 31P-NMR spectroscopy revealed inorganic orthophosphate and monoesters-P as the major forms in this area. The proportions of Pi and Po evaluated by sequential chemical extraction and 31P-NMR spectroscopy were basically consistent. The results indicated that the soils were in weathered conditions. Furthermore, the P distribution and forms significantly differed between the upland and lowland by variation in elevation and eolian aggradation effects in this coastal sand dune landscape.

The electronic structural evolution of LLM-105 crystal and the (101) plane of LLM-105 crystal under different pressures is investigated by the density functional theory (DFT) calculations and the surface properties of seven low-Miller-index planes of LLM-105 crystal were investigated in this study. The result demonstrates that the surface energy of (101) plane of LLM-105 is much smaller when compared with other low-Miller-index planes of LLM-105.In order to further investigate the stability of crystal structure and (101) plane of LLM-105 under different pressures, a series of pressures ranged from 0 GPa to 55 GPa were applied during the DFT calculation, and the result shows that the electronic structures of LLM-105 crystal and the (101) plane changed with the increase of external pressure and the evolution process of (101) plane is different from that of LLM-105 crystal structure.

This paper studied the dynamic characteristics of the deployment process of the replaceable interface mast and the vibration generated at the end of the mast. The interface is discretized by the absolute nodal coordinate thin shell element with gradient reduction, and the three-dimensional motion of the reconfigurable rigid body module is described by the natural coordinate method. The dynamic equations of the interface and the reconfigurable module without external constraints are established by the principle of virtual work. Finally, the dynamic models of each part are assembled into the dynamic model of the mast system deployment process through the system constraint equation. According to the established dynamic model of the mast system deployment process, the dynamic behavior changes of the replaceable interface mast are analyzed. At the same time, the differences in the deployment behavior of the replaceable interface mast under different system configuration schemes, flexible interface geometric parameters, and different driving laws are studied and compared. It provides guidance for the scheme configuration of the mast system, the structural design of the interface, and the deployment motion planning of the mast. According to the physical prototype and the assembly of the mast system model, the deployment process of the replaceable interface mast is experimentally analyzed. It shows that the established dynamic model of the mast system can correctly analyze the dynamic characteristics of the deployment behavior of the replaceable interface mast, which provides a reference for the design and behavior analysis of the mast system.

Microbiota-based strategies are a novel auxiliary therapeutic and preventative way of moderating chronic kidney disease. Lactobacillus mixture (Lm) was previously demonstrated to exert a renal-protective function in the CKD mice model. The efficacy of probiotics in pet foods is a relatively new area of study, and thus verifying the potential health benefits is necessary. This study evaluated the efficacy of Lm treats in feline CKD and elucidated the mechanisms underlying host-microbe interactions. CKD cats (2 and 3 stages) were administrated probiotic pet treats daily (10 g) for 8 weeks. The results demonstrated that during the eight weeks of Lm administration, creatinine was reduced or maintained in all cats with CKD. Similarly, gut-derived uremic toxins (GDUT), IS, and TMAO were significantly downregulated in the serum (confidence intervals = 90%). The life quality of the cats also improved. Feline gut microbiome data, KEGG pathway, and renal function indicator analyses revealed the possible mechanisms involved in modulating CKD feline microbial composition. Further regulation of the microbial functions in amino acid metabolism after Lm administration contributed to downregulating deleterious IS, PCS, and TMAO. The current study provides potential adjuvant therapeutic insights into probiotic pet foods or treats for pets with CKD.

Adipose-derived stem cells (ADSCs) were suggested for treating degenerative osteoarthritis, suppressing inflammatory responses, and repairing damaged soft tissues. Moreover, the ADSCs have the potential to undergo self-renewal and differentiate into bone, tendon, cartilage, and ligament. Recently, investigation of the self-renewal and differentiation of the ADSCs becomes an attractive area. In this work, a pneumatic microdevice has been developed to study the gene expression of the ADSCs after the stimulation of multi-axial tensile strain. The ADSCs were cultured on the microdevice and experienced multi-axial tensile strain during a 3-day culture course. Self-renewal and differentiation abilities were investigated by mRNA expressions of NANOG, SOX2, OCT4, SOX9, PPAR-γ, and RUNX2. The result showed that the genes related self-renewal were significantly up-regulated after the tensile stimulation. Higher proliferation ratio of the ADSCs was also shown by cell viability assay. The microdevice provides a promising platform for cell-based study under mechanical tensile stimulation.

3D Zernike moments based on 3D Zernike polynomials have been successfully applied to the field of voxelized 3D shape retrieval and have attracted more attention in biomedical image processing. As the order of 3D Zernike moments increases, both computational efficiency and numerical accuracy decrease. Due to this phenomenon, a more efficient and stable method for computing high-order 3D Zernike moments was proposed in this study. The proposed recursive formula for computing 3D Zernike radial polynomials combines the recursive calculation of spherical harmonics to develop a voxel-based algorithm for the calculation of 3D Zernike moments. The algorithm was applied to the 3D shape Michelangelo's David with a size of 150×150×150 voxels. As compared to the method without additional acceleration, the proposed method uses a group action of order sixteen orthogonal group and saving unnecessary iterations, the factor of speed-up is 56.783±3.999 when the order of Zernike moments is between 10 and 450. The proposed method also obtained an accurate reconstructed shape with the error rate (normalized mean square error) of 0.00 (4.17×10^-3) when the reconstruction was computed for all moments up to order 450.

This paper examines certain implications from the literature on Tiebout’s model of local gov-ernment service provision, particularly Hamilton’s extension of the model to include local control of land use and property taxation. Our empirical analysis focuses on the use of fiscal zoning to lower property tax rates, a topic that has not been addressed in the extensive Tiebout literature. Using data for over 100 municipalities in the Miami, Florida, metropolitan area, we specify property tax rates as a function of fiscal zoning measures, other municipal characteristics, and tax mimicking. We conclude that single-family zoning is by far the most important variable ex-plaining municipal property tax rates.

Concrete cracks and local damage can affect the bond performance between concrete and steel bars, thereby reducing the durability of reinforced concrete structures. Compared with general concrete crack repair methods, biomineralization repair not only has effective bonding capabilities but is also particularly environmentally friendly. In view of this, this study aimed to apply biomineralization technology to repair damaged fiber-reinforced lightweight aggregate concrete (LWAC). Two groups of LWAC specimens were prepared. The control group used lightweight aggregates (LWAs) without bacterial spores and nutrient sources, and the experimental group used LWAs containing bacterial spores and nutrient sources. These specimens were first subjected to compression tests and pull-out tests, respectively, and thus were damaged. After the damaged specimen healed itself in different ways for 28 days, secondary compression and pull-out tests were conducted. The self-healing method of the control group involved placing the specimens in an incubator. The experimental group was further divided into experimental group I and experimental group II. The self-healing method of experimental group I was the same as that of the control group. The self-healing method of experimental group II involved soaking the specimen in a mixed solution of urea and calcium acetate for two days, and then taking it out and placing it in an incubator for two days, with a cycle of four days. The test results showed that, compared with the control group specimens, the relative bond strength ratio of the experimental group II specimens increased by 17.9%. Moreover, the EDS and XRD analysis results confirmed that the precipitate formed at the crack was calcium carbonate, which improved the compressive strength and bond strength after self-healing. This indicates that the biomineralization maintenance method used in experimental group II is more effective.

We present three reduced integrable hierarchies of nonlocal integrable NLS type equations from a vector integrable hierarchy associated with a matrix Lie algebra, not being A type. Three similarity transformations are taken to keep the invariance of the transformed zero curvature equations. The key step is to formulate a solution to a reduced stationary zero curvature equation so that the zero curvature formulation works for a reduced case.

Construction productivity entails a wide range of work combinations. When human resources are scarce, it is critical to replace manpower with machinery, and calculating machinery productivity is crucial. Traditional labor productivity methods, however, cannot address dredging complex multi-attribute decision-making (MADM) problems. Aiming to address the limitations of the traditional labor productivity method, this paper extends the data envelopment analysis (DEA) and proposes a new dredging productivity evaluation method. The proposed method can solve the problem of evaluating various combinations of factors (single-input, multiple-input, sin-gle-output, and multiple-output) and the problem suggesting that the efficiency of the DEA method'scalculation results is equal to 1. The effectiveness of the proposed method was verified using reservoir dredging examples. The simulation results show that the proposed method has broad applicability, can accurately evaluate the related dredging performance issues, and provide directions for construction managers to improve labor productivity.

Canine atopic dermatitis (CAD) is a common chronic allergic skin disease. In our previous study, we isolated two probiotic strains, Lactococcus cremoris subsp. cremoris MP01 and Lacticaseibacillus paracasei subsp. paracasei MP02, from Mongolian fermented milk. These strains demonstrated potential in alleviating symptoms similar to AD and reducing specific immunoglobulin E (IgE) levels in a mouse model of AD. Building upon this discovery, our current investigation sought to evaluate the therapeutic potential of these probiotics for treating CAD. We conducted an open-label, single-arm clinical trial where dogs diagnosed with AD were administered LCP capsules containing Lc. cremoris subsp. cremoris MP01 and L. paracasei subsp. paracasei MP02 once daily for 60 days. Stool, skin swab, and venous blood specimens were collected at three intervals: before, and after 30 and 60 days of LCP intervention. The skin and fecal microbiomes were analyzed using full-length 16S rRNA sequencing. After 60 days of LCP intervention, notable improvements were observed in skin lesions and scratching behaviors, accompanied by reductions in both the Canine Atopic Dermatitis Extent and Severity Index (CADESI) and the Pruritus Visual Analogue Scale (PVAS) scores. Additionally, LCP intervention resulted in significant reductions in IgE levels and modulation in type 1 T helper (Th1)/ type 2 T helper cells (Th2)-related cytokine secretion. Microbiota analysis unveiled changes in the composition of both skin and gut microbiotas, including reductions in Shigella flexneri on the skin and Romboutsia in the gut. Levels of short-chain fatty acid (SCFA) increased following the 60-days of LCP intervention. These effects were likely mediated by alterations in gut microbiota and the upregulation of SCFA levels, which subsequently reduced the secretion of allergy-related IgE. Collectively, these mechanisms contributed to alleviating CAD symptoms, regulating skin microbiota composition, and reducing the adherence and invasion of environmental microbes and pathogens. Overall, our findings highlight the promising therapeutic potential of the Lc. cremoris subsp. cremoris MP01 and L. paracasei subsp. paracasei MP02 mixture as an effective strategy for managing CAD in dogs.

In response to the growing need for efficient energy conversion technologies, this pa-per introduces an innovative Tubular Thermoelectric Generator (TTEG), specifically de-signed for high-efficiency conversion of waste heat into electrical energy. Unlike conven-tional flat plate thermoelectric generators (FTEGs), the TTEG incorporates full-ring ther-moelectric elements within a tubular layout, offering a novel approach to thermal energy recovery from fluid-based systems. This design significantly enhances the heat transfer capabilities, thereby improving the efficiency of energy conversion. Comprehensive simulations and analyses form the core of this study, where the per-formance of the TTEG is rigorously compared with traditional FTEGs. These comparisons highlight the advantages of the tubular design in terms of energy conversion efficiency and practical applicability in various scenarios. The findings reveal that the TTEG not only outperforms its flat plate counterparts but also presents a scalable and adaptable so-lution for waste heat recovery in a wide range of industrial and automotive applications. This research contributes to the field of energy science and technology by presenting a detailed experimental setup, complete with reproducible procedures and results. It opens new pathways for the development of more sustainable and efficient energy conversion systems, aligning with the goal of harnessing renewable and sustainable energy sources. The potential applications of this technology in enhancing energy efficiency and reducing environmental impact are vast, making it a significant step forward in the quest for clean and sustainable energy solutions.

Due to their excellent physicochemical properties, fluorinated greenhouse gases (F-gases), including hydrofluorocarbons (HFCs), perfluorocarbons (PFCs), sulfur hexafluoride (SF6), and nitrogen trifluoride (NF3), are used in a variety of applications, but they are potent greenhouse gases. Therefore, they have been blanketed into the list of phase-out under the international protocols or treaties. In this work, the updated statistics of the Taiwan’s national inventory report (NIR) were used to analyze the trends of F-gases (i.e., HFCs, PFCs, SF6 and NF3) emissions during the period of 2000-2020. Furthermore, the regulatory strategies and measures for reducing the emissions of the four F-gases will be summarized to be in accordance with the national and international regulations. With the progressive efforts by the regulatory requirements and the industry’s voluntary reduction, the total F-gases emissions indicated a significant increase from 2,462 kilotons of carbon dioxide equivalents (CO2eq) in 2000 to the peak value (i.e., 12,643 kilotons) of CO2eq in 2004, but sharply decreased from 10,284 kilotons of CO2eq in 2005 to 3,906 kilotons of CO2eq in 2020. It was also found that the most commonly used method for controlling the emissions of F-gases from the semiconductor and optoelectronic industries was based on the thermal destruction-local scrubbing technology.

Estimates of extreme water level return periods in river systems are crucial for hydraulic engineering design and planning. Recorded historical water level data of Taiwan’s rivers are not long enough for traditional frequency analyses when predicting extreme water levels for different return periods. In this study, the integration of a one-dimensional flash flood routing hydrodynamic model with the Monte Carlo simulation was developed to predict extreme water levels in the Danshuei River system of northern Taiwan. The numerical model was calibrated and verified with observed water levels using four typhoon events. The results indicated a reasonable agreement between the model simulation and observation data. Seven parameters, including the astronomical tide and surge height at the mouth of the Danshuei River and the river discharge at five gauge stations, were adopted to calculate the joint probability and generate stochastic scenarios via the Monte Carlo simulation. The validated hydrodynamic model driven by the stochastic scenarios was then used to simulate extreme water levels for further frequency analysis. The design water level was estimated using different probability distributions in the frequency analysis at five stations. The design high-water levels for a 200-year return period at Guandu Bridge, Taipei Bridge, Hsin-Hai Bridge, Da-Zhi Bridge, and Chung-Cheng Bridge were 2.90 m, 5.13 m, 6.38 m, 6.05 m, and 9.94 m, respectively. The estimated design water levels plus the freeboard are proposed and recommended for further engineering design and planning.

This paper presents a deep learning-based multi-guidance line detection approach, enabling an autonomous four-wheeled agricultural robot to navigate strip farmland. The integration of Proportional-Integral-Derivative (PID) and Fuzzy Logic Control (FLC) systems optimizes the velocity and heading angle of robot, facilitating smooth navigation along identified guidance line. Enhance cornering maneuverability with real-time kinematics (RTK)-assisted Global Navigation Satellite System (GNSS) (RTK-GNSS) positioning. Additionally, the spraying system combined with deep learning can effectively identify weeds and crop nutrient deficiencies to achieve precise spraying. The guidance system prioritizes irrigation lines for navigation, with additional guidance from crop and furrow lines. Trigonometric analysis determines the angular deviation between the identified guidance line and the vertical line of the top view image. Experiments under diverse weather conditions demonstrate the stable navigation of robot at 12.5 cm/s, achieving up to 90% accuracy in weed and nutrient deficiency identification. The spraying accuracy for weeds and deficiencies averages 87% and 73%, respectively, underscoring the system's contribution to sustainable and precision horticulture practices.

To reveal the influence of variables such as entrepreneurial learning, entrepreneurial inspiration, and incubation resources on students' entrepreneurial intentions in vocational colleges, this study took vocational colleges in Zhejiang Province, a province with a strong entrepreneurial climate in China, as an example. The study used a questionnaire to obtain data, and 614 valid questionnaires were collected from seven vocational colleges. The study divided entrepreneurship education into three dimensions: entrepreneurial learning, entrepreneurial inspiration, and incubation resources, and used structural equation modeling to investigate the influence of entrepreneurship education on entrepreneurial intentions while introducing entrepreneurial efficacy as a mediating variable to examine the influence mechanism of entrepreneurship education on entrepreneurial intentions of higher education students. The results showed that entrepreneurial learning, entrepreneurial inspiration, incubation resources, and entrepreneurial efficacy were all significantly and positively correlated with entrepreneurial intentions and that entrepreneurial efficacy mediated between the two dimensions of entrepreneurship education (entrepreneurial learning and entrepreneurial inspiration) and entrepreneurial intentions. Therefore, to enhance the effectiveness of entrepreneurship education in vocational institutions, we should stimulate students' sense of entrepreneurial efficacy, strengthen their entrepreneurial learning and inspire them to start their businesses. In turn, university incubation resources can be developed and utilized to enhance students' entrepreneurial confidence and intentions.

Embryo stage of oxidation of an epi Ge(001)-2×1 by atomic oxygen and molecular O₂ is studied via synchrotron radiation photoemission. The topmost surface buckled with the up- and down-dimer atoms and the first subsurface layer behave distinctly from the bulk by exhibiting surface core-level shifts in the Ge 3d core-level spectrum. The O₂ molecules become dissociated upon reaching the epi Ge(001)-2×1 surface. One of the O atom removes off the up-dimer atom, and the other bonds with the underneath Ge atom in the subsurface layer. Atomic oxygen adsorbed on the epi Ge(001)-2×1 preferentially in between the up-dimer atoms and the underneath subsurface atoms without affecting the down-dimer atoms. The electronic environment of the O-affiliated Ge up-dimer atoms becomes similar to that of the down-dimer atoms. Both exhibit an enrichment in charge, where the subsurface of the Ge layer is maintained in a charge-deficient state. The dipole moment originally generated in the buckled reconstruction no longer exists, thereby resulting in a decrease in the ionization potential. The down-dimer Ge atoms and the back-bonded subsurface atoms remain inert to atomic O and molecular O₂, a possible cause of low reliability in Ge-related metal-oxide-semiconductor (MOS) devices.

The main purpose of study is to identify the impact of COVID-19 pandemic on the green financing of banks and non-bank financial institutions (NBFIs) in an emerging economy such as Bangladesh. Also, this study shows the green banking activities of the banks and NBFIs during the pandemic. To analyze the impact of the pandemic on green financing, secondary data were obtained from the quarterly and annual reports of Bangladesh Bank (BB) on green financing as well as the annual reports and websites of 61 banks and 34 NBFIs in Bangladesh for the period 2021–2019. Subsequently, the study deployed dependent t-test statistics, growth rate (year-on-year), descriptive statistics, relative percentage changes, and varying tables and graphs to analyze the obtained secondary data. The empirical findings revealed that during the COVID-19 pandemic, there was an increase in green finance for all banks and NBFIs compared to before the epidemic, indicating that the pandemic had no negative impact on the total green finance growth of all banks and NBFIs. On the other hand, compared to the pre-pandemic period, bank-wise growth in green financing was higher for state-owned commercial banks (SOCBs), specialized banks (SDBs), and private commercial banks (PCBs) but lower for foreign-owned commercial banks (FCBs) during the COVID-19 epidemic. This suggests that the pandemic does not affect the expansion of green finance by SOCBs, SDBs and PCBs but significantly impacted the growth of green financing by FCBs. Furthermore, the research findings showed that the total outstanding and classified loans within the green finance investment decrease for both banks and NBFIs during the COVID-19 pandemic. The results indicated that the Bangladeshi banks’ level of automation towards green banking were satisfactory during the pandemic. Therefore, major policy implications for the green economic recovery by the government, BB, and managers of the banks and financial institutions in emerging economies like Bangladesh were discussed.

The purpose of this study was to arrange a green roof on a sheet metal house to achieve winter heat preservation and summer thermal insulation using different plants and soil media, and to maintain the advantage of cost-saving and quick installation of sheet metal houses. In terms of the research method, the roof insulation, heat preservation and plant growth index were tested. Plants were grown in 10 container-type green roofs on the sheet metal house roof, and the physical environment of the building was monitored for one year. Five containers of commercially-available culture soil and five containers of sustainable composite were used as the media for growing five kinds of plants, respectively. The control group only had a sheet metal house roof. There were 11 experimental modules for testing whether the green roofs had thermal insulation, heat preservation and plant growth effects on a general sheet metal house. The results showed that, regarding the thermal insulation benefit assessment, the Sedum acre cv. robustum of green roof Groups B to D caused the temperature to be 38.29°C lower than the surface of the simple sheet metal house roof in August, showing a temperature difference of 54%.

To study the coupling mechanism and dynamic response of the end-face movable gear trans-mission system under complex excitation, a specific configuration of end-meshing movable gear reduction mechanism was used to achieve predetermined rigid thrust transmission and mis-matched gear meshing functions, which solved the inherent defects of traditional harmonic gear mechanism thin-wall flexible wheel easy to be damaged by fatigue. Considering the phenomenon of elastic deformation of live teeth accompanied by significant changes in meshing characteristics in the transmission process of end-meshing harmonic reducer, the influence of dynamic meshing parameters, live tooth deformation, time-varying stiffness of tooth meshing, and time-varying backlash on nonlinear dynamic performance was explored, as well as the mechanism of mul-ti-parameter coupling on transmission performance. The nonlinear dynamics model of the end-meshing harmonic reducer is established to solve the chattering prediction problem. Finally, a comprehensive test bed for the transmission system of harmonic reducer with meshing type with adjustable characteristic end was built to verify the correctness of the theoretical model and provide the theoretical and technical basis for exploring the optimal parameter selection of pas-sive vibration suppression problem.

Many spatial decision support systems suffer from user adoption issues in practice due to lack of trust, technical expertise, and resources. Automated machine learning has recently allowed non-experts to explore and apply machine learning models in the industry without requiring abundant expert knowledge and resources. This paper reviews recent literature from 136 papers, and proposes a general framework for integrating spatial decision support systems with automated machine learning to lower major user adoption barriers. Challenges of data quality, model interpretability, and practical usefulness were discussed as general considerations for system implementation. Research opportunities related to spatially explicit models in AutoML, and resource-aware, collaborative/connected, and human-centered systems were also discussed to address these challenges. This paper argues that integrating spatial decision support systems with automated machine learning can not only encourage user adoption, but also mutually benefit research in both fields — bridging human-related and technical advancements for fostering future developments in spatial decision support systems and automated machine learning.

To facilitate the promotion and application of the whole process engineering consulting (WPEC) model, the transmission mechanism of influencing factors in WPEC's promotion and application is investigated. It identifies and categorizes the influencing factors within the framework of "external environment-project factors-stakeholders", systematically organizing and summarizing ten primary categories and thirty-eight secondary influencing factors of WPEC's promotion and ap-plication. Utilizing the complex network analysis method, a network of influencing factors in the promotion and application of WPEC is constructed. The network is then converted into three binary networks based on weight, which are subjected to structural analysis and motif analysis. On this basis, the transmission mechanism of influencing factors in WPEC's promotion and applica-tion and its causations are explored.

We investigate the flow structure and dynamics of moderate-Rayleigh-number ($Ra$) thermal convection in a two-dimensional inclined porous layer. Direct numerical simulations (DNS) confirm the emergence of $\mathit{O}(1)$ aspect-ratio large-scale convective rolls, with one `natural' roll rotating in the counterclockwise direction and one `antinatural' roll rotating in the clockwise direction. As the inclination angle $\phi$ is increased, the background mean shear flow intensifies the natural-roll motion, while suppressing the antinatural-roll motion. Moreover, our DNS reveal---for the first time in single-species porous medium convection---the existence of \emph{spatially-localized} convective states at large $\phi$, which we suggest are enabled by subcritical instability of the base state at sufficiently large inclination angles. To better understand the physics of inclined porous medium convection at different $\phi$, we numerically compute steady convective solutions using Newton iteration and then perform secondary stability analysis of these nonlinear states using Floquet theory. Our analysis indicates that the inclination of the porous layer stabilizes the boundary layers of the natural roll, but intensifies the boundary-layer instability of the antinatural roll. These results facilitate physical understanding of the large-scale cellular flows observed in the DNS at different values of $\phi$.

For improving the tracking accuracy and model switching speed of maneuvering target tracking in nonlinear systems, a new algorithm named interacting multiple model fifth-degree spherical simplex-radial cubature filter (IMM5thSSRCKF) is proposed in this paper. The new algorithm is a combination of the interacting multiple model (IMM) filter and fifth-degree spherical simplex-radial cubature filter (5thSSRCKF). The proposed algorithm makes use of Markov process to describe the switching probability among the models, and uses 5thSSRCKF to deal with the state estimation of each model. The 5thSSRCKF is an improved filter algorithm, which utilizes the fifth-degree spherical simplex-radial rule to improve the filtering accuracy. Finally, the tracking performance of the IMM5thSSRCKF is evaluated by simulation in a typical maneuvering target tracking scenario. Simulation results show that the proposed algorithm has better tracking performance and quicker model switching speed when disposing maneuver models compared with IMMUKF, IMMCKF and IMM5thCKF.

As the COVID-19 pandemic has caused enormous damage to society, economy and public health security, it is crucial to combat the epidemic and allocate social and health resources effectively. Global optimization algorithms are extensively used in many domains to find optimal solutions to complex problems. Thus, a survey of three typical global optimizations applied on the COVID-19 pandemic is timely. This article is structured into three typical global optimization algorithms - Genetic Algorithm, Particle Swarm Optimization, and Cat Swarm Optimization - and summarizes the framework models and practical applications, as well as other optimization methods that may be applied to COVID-19. Finally, current unresolved challenges and future research opportunities to be explored are summarized.

In this paper, we establish the necessary and sufficient conditions for solving a dual split quaternion matrix equation AXB=C, and present the general solution expression when solvability is achieved. As an application, we delve into the necessary and sufficient condition for the existence of Hermitian solution to this equation by using a newly defined real representation method. Furthermore, we obtain the solutions for the dual split quaternion matrix equations AX=C and XB=C. Finally, we provide a numerical example to demonstrate the findings of this paper.

Semenov-Tian-Shansky has introduced the modified classical Yang-Baxter equation, which is called the modified $r$-matrix. Relevant studies have been extensive in recent times. This paper is devoted to study cohomology theory of modified Rota-Baxter pre-Lie algebras and its applications. First we introduce the concept and representations of modified Rota-Baxter pre-Lie algebras. We then develop the cohomology of modified Rota-Baxter pre-Lie algebras with coefficients in a suitable representation. As applications, we consider the infinitesimal deformations, abelian extensions and skeletal modified Rota-Baxter pre-Lie 2-algebra in terms of lower degree cohomology groups.

In this paper, we define the cohomology of a modified $\lambda$-differential left-symmetric algebra with coefficients in a suitable representation. We also introduce the notion of modified $\lambda$-differential left-symmetric 2-algebra. We classify linear deformations and abelian extensions of modified $\lambda$-differential left-symmetric algebras using the second cohomology group and classify skeletal modified $\lambda$-differential left-symmetric 2-algebra using the third cohomology group as our propose cohomology applications. Moreover, we prove that strict modified $\lambda$-differential left-symmetric 2-algebras are equivalent to crossed modules of modified $\lambda$-differential left-symmetric algebras.

The effects of heating rate before solution treatment and cooling rate after solution treatment on the morphological distribution and evolution of precipitation phase of nickel-based single crystal superalloy were studied. The dissolution, precipitation and growth of precipitation phase and matrix phase during heat treatment were analyzed by means of high power scanning electron microscopy. The results show that the morphology of precipitated phase has nothing to do with the distribution of precipitated phase and the heating rate in the heating process, but the cooling rate in the cooling process affects the shape, size and distribution of precipitated phase. The faster the cooling rate, the smaller the precipitated phase is, the more irregular the shape is, the smaller the equivalent edge length is, and the smaller the channel width of matrix phase is.

We investigated new anodic coloring materials that are used as ion storage layers in complementary energy storage electrochromic devices (ESECDs) to enhance their electrochromic storage performance. In this study, we fabricated counter electrodes (ion storage layers) using IrO2 doping NiO (Ir: NiO) film through cathodic arc plasma (CAP) with varying surface charge capacities. We investigated the influence of MoO3-doped WO3 (Mo: WO3) film by various Ar/O2 gas flow ratios (1/4, 1/5, and 1/6). The ESECDs used in the demonstration were 10×10 cm2 in size. They achieved optical transmittance modulation of Ir: NiO- ESECDs (glass/ITO/ Mo: WO3/gel-polymer electrolytes/ Ir: NiO /ITO/glass), ΔT=53.3% (from Tbleaching (66.6%) to Tcoloration (13.1%)). The ESECDs had a quick coloration time of 3.58 seconds, a rapid bleaching time of 1.24 seconds, and high cycling durability. It remained at 45% transmittance modulation even after 3000 cycles. New anodic materials can provide an alternative to traditional active materials for bi-functional electrochromic batteries.

With the improvement in medical quality, cold mechanical rehabilitation equipment can no longer meet the psychological needs of the physically handicapped. Therefore, design for behaviour change should be viewed as a strategy for enabling lifestyle changes as soon as possible. Although how to use equipment to assist physically disabled people in hydrotherapy rehabilitation is the primary design goal, the psychological feelings of users are also one of the focuses of this study. Besides, coupled with the large-scale spread of the Coronavirus Disease (COVID-19) in the past two years. People's living habits are also forced to change, many activities that people are used to doing outdoors are being slowly completed at home. During the epidemic, it is very dangerous and inconvenient for users who need to go to institutional rehabilitation regularly. Hence, it is urgent to change past usage habits and places. In this study, a personal multi-functional hydrotherapy bucket is designed. In addition to not having to use a public spa with other people to reduce the risk of contracting the Coronavirus Disease, it can be easily placed at home by reducing its size. According to market research, it is known that the current domestic hydrotherapy buckets on the market usually only have a single function. The large medical hydrotherapy pools are not only rare in Taiwan, but this kind of equipment also takes up a lot of space. Various factors have resulted in a relatively low market share of hydrotherapy pools compared to other rehabilitation equipment. In order to take into account, the physical and psychological needs of the physically disabled, this research focus on the design of a multi-functional but small-sized hydrotherapy bucket. Taking the convenience of entering and leaving the bucket as the starting point to improve the shortcomings of the existing products, on the other hand, because most users are inconvenient to move, safety is also the focus of the design to reduce the occurrence of accidents and injuries. This study is based on the systematic design methodology of concurrent design to obtain product design results. Firstly, conduct market research and select products from different manufacturers for analysis and comparison. Through functional analysis and sorting out the problem points, the TRIZ theory and the morphological diagram method are used to find the solution to the problem. Finally, the best design scheme is obtained by the PUGH method. Besides, construct a 3D model to present the design concept that meets the design goals. The research results are hoped to be used as a reference for designing and developing related products, thereby increasing the home's multifunctional hydrotherapy buckets' market share.

In this study, we designed a structural model to determine the relationships among push–pull factors, institutional situations, and satisfaction during the COVID-19 pandemic. The 17 selected indicators fell under five domains, namely push factors, pull factors, institutional leadership, international strategies, and satisfaction. Structural equation modeling (SEM) was used to verify the assumptions of the model. Based on 1005 degree-seeking international students' views, this study found that push and pull factors may coincidentally exist, and their functions can be modified by institutional situations. The findings suggest pull factors will, through institutional leadership, impact students' satisfaction, while push factors will not. Moreover, the detection of institutional mediation can provide useful information for specific institutes to develop their future recruiting or retaining strategies. These findings enriched our knowledge of the field during the pandemic. For future studies, this design may be useful to interpret the phenomena of global student mobility in higher education settings.

(1) Background: Due to the high proportion of disadvantaged students in a rural school in Taiwan and the gap between students’ concepts and practices of environmental protection and sustainable energy, four science and mathematics teachers in this school planned an engineering-centered PjBL of sustainable energy curriculum in a Makers Club to enhance students’ creativity, engineering skills, practices of environmental protection and sustainable energy, and learning attitudes; (2) Methods: This study is four-year action research. Teachers and students initiated the idea from rebuilding an old fan in a classroom; (3) Results: The students in the Makers Club improved their engineering skills and created various green-power generation devices (evolved from ventilation ball generator, hydropower, ocean current power generators to tiny, 3D-printing wind power generators). They turned environmental protection and sustainable energy concepts into actions during practices and won awards from science and engineering fairs every year. This creative and supportive atmosphere spread from the club to the whole school and improved the students’ practices of environmental protection and learning attitudes after long-term implementation; (4) Conclusions: The design principles of the engineering-centered PjBL of sustainable energy curriculum played a critical role and were outlined at the end of the study.

A large amount of accurate river cross-section data is indispensable for predicting river stages. However, the measured river cross-section data are usually sparse in the transverse direction at each cross-section as well as in the longitudinal direction along the river channel. This study presents three algorithms to resample the river cross-section data points in both the transverse and longitudinal directions from the original data. The resampled cross-section data based on the linear interpolation satisfactorily maintains the topographic and morphological features of the river channel, especially in the meandering river segment. A two-dimensional (2D) high-resolution unstructured-grid hydrodynamic model was used to assess the performance of the original and resampled cross-section data on a simulated river stage under low flow and high flow conditions. The simulated river stages are significantly improved using the resampled cross-section data based on the linear interpolation in the tidal river and non-tidal river segments. Furthermore, the performance of the 2D and three-dimensional (3D) models on the simulated river stage was also evaluated using the resampled cross-section data. The results indicate that the 2D and 3D models reproduce similar river stages in both tidal and non-tidal river segments under the low flow condition. However, the 2D model overestimates the river stages in both the tidal and non-tidal river segments compared to the 3D model under the high flow condition. The model sensitivity was implemented to investigate the influence of bottom drag coefficient and vertical eddy viscosity on river stage. The results reveal that bottom drag coefficient has a minor impact on river stage, but the vertical eddy viscosity is insensitive to river stage.

The use of smart grids has enabled a number of planning methods to be developed to optimize energy costs, Peak to Average Ratios (PARs), and consumer satisfaction for load management in industrial, commercial, and domestic sectors. From a technical point of view, achieving optimal outcomes requires Demand Side Management (DSM). In smart grids, utility companies and electric users communicate two-way using digital technology to make a sustainable and economic system. This paper proposes a novel framework within which an Energy Management Controller (EMC) keeps track of each appliance, its operational time, and the costs associated with them. Customers of smart grids are motivated to shift their Off-Peak Hours (OPH) from Peak Hours by presenting incentives in OPH. The metering devices would also save customers costs by preventing load shifting between high- and low-cost periods. In addition, the study proposes the bacterial foraging algorithm and grasshopper optimization algorithm for lessening power price and PAR without compromising user comfort (UC) through appliance planning. The simulation results on a practical test system advocate the high effectiveness and reliable performance of the proposed model.

Determining accurate PM2.5 pollution concentrations and understanding their dynamic patterns is crucial for scientifically informed air pollution control strategies. Traditional reliance on linear correlation coefficients for ascertaining PM2.5 related factors only uncovers superficial relationships. Moreover, the invariance of conventional prediction models restricts their accuracy. To enhance the precision of PM2.5 concentration prediction, this study introduces a novel integrated model that leverages feature selection and a clustering algorithm. Comprising three components - feature selection, clustering, and integrated prediction, the model first employs the non-dominated sorting Genetic Algorithm (NSGA-III) to identify the most impactful features affecting PM2.5 concentration within air pollutants and meteorological factors. This step offers more valuable feature data for subsequent modules. The model then adopts a two-layer clustering method (SOM+K-means) to analyze the multifaceted irregularity within the dataset. Finally, the model establishes the Extreme Learning Machine (ELM) weak learner for each classification, integrating multiple weak learners using the Adaboost algorithm to obtain a comprehensive prediction model. Through feature correlation enhancement, data irregularity exploration, and model adaptability improvement, the proposed model significantly enhances the overall prediction performance. Data sourced from 12 Beijing-based monitoring sites in 2016 were utilized for an empirical study, and the model's results compared with five other predictive models. The outcomes demonstrate that the proposed model significantly heightens prediction accuracy, offering useful insights and potential for broadened application to multifactor correlation concentration prediction methodologies for other pollutants.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Afghanistan is overwhelmed with food insecurity that is a large percentage of the population lacks reliable access to food supplies. Grains play a vital role in the country's food security due to their importance in terms of consumption and production quantity. This paper estimates cereal self-sufficiency and then makes a food balance forecast of the three major food crops cultivated in Afghanistan over six-decades. Descriptive statistics and coarse metric techniques were employed to determine cereal self-sufficiency and food balance forecast. The econometric analysis demonstrated that (1) Afghanistan is not yet self-sufficient in meeting grain consumption, and the production and consumption ratio declined from 0.9 to 0.55 from 1979 to 2030. (2) The gap of theoretical food imbalance will increase, and by the year 2030, cereal production will likely be sufficient for only 49.8 percentage of inhabitants, leaving a high shortage equivalent to the amount required by 24.4 million people. By evaluating the quantitative food balance and the growing population change, this study presents an analysis of the emerging threat to Afghanistan's food security and suggests a solution for food security, should increase the size of public agricultural expenditure, improve the level of agriculture infrastructure, and continue to introduce a policy to achieve higher yield.

In the current study, a two-dimensional numerical study is carried out to investigate the performance of a novel Double-chamber Parallel Flexible Valves micropump, which utilized the electrowetting-on-dielectrics (EWOD) effect to drive the microfluid flow. By observing the flow fields, the internal circulations are seen on both the left and right side of the pump. The generation of the backflow is discussed by tracking the movement of the vortices. Only slight flow fluctuation is seen in the micropump. Based on the simulation outcomes, the structural parameters including the width of the inlet/outlet, the width of the pumping channel and the diverging angle in the micropump are analyzed, the influence of these parameters on the pumping volume and the maximum pressure have been discussed. Eventually, a group of optimal parameter combinations is given according to the results to extend the operating potential of the micropump.

The mobile payment has been emerging as an alternative to cash and credit cards and is rapidly evolving around the world. This study integrated the general model of innovation diffusion theory (IDT) with the technology acceptance model (TAM) to examine the impact of near-field-communication (NFC) mobile payment environment on the restaurant operating performance (ROP). This paper used convenience sampling to distribute questionnaires to restaurant owners and managers in order to investigate the impact of NFC mobile payment environment on ROP. A total of 279 valid questionnaires were collected. The empirical results show that sales growth, cost saving, flexibility, accessibility and trust & safety had significantly positive impacts on ROP. After considering the restaurant size as a moderator for analysis, there are only two constructs- accessibility and trust & safety had significant impacts on ROP. This empirical finding could provide restaurateurs with a reference to improve ROP by increasing the mobile payment environment.

A recent study found that a 3ppb increase in O₃ ambient concentration was associated with an increased progression of 0.18 percentage points in percent emphysema and that such increase was equal to smoking 20 cigarettes per day for 29 years. A simple estimation of population attributable fraction shows that COPD diagnoses due to smoking are actually 30 times more than those attributed to a 3 ppb increment in O₃ concentration. Labelling ozone pollution as the new smoking may distort perception of the risks and hinder proper response to real life threatening risk such as smoking.

This study investigates the influence of expectations and trust on farmers' decisions regarding contractual choices in land transfer. The dataset used for analysis consists of 1101 households in Guizhou Province. The research focuses on two aspects: the selection between written and oral contracts, and the decision to continue the contractual relationship. The findings reveal that farmers' choices are significantly affected by their expectations and levels of trust.Specifically, when farmers' expectations regarding the land transfer process are not met, they tend to prefer written contracts over oral ones. This preference can be attributed to the greater clarity and risk reduction offered by written contracts. On the other hand, higher levels of trust increase the likelihood of farmers continuing the land transfer contract, as trust fosters a sense of confidence and security in the ongoing relationship.Interestingly, trust also plays a moderating role. Farmers who have aligned expectations and high levels of trust are more inclined to opt for oral contracts. This preference for oral contracts can be attributed to their flexibility and emphasis on interpersonal relationships, allowing for better adaptation to the changing dynamics of land transfer.These findings contribute to a deeper understanding of the factors influencing farmers' decision-making processes regarding contractual choices in land transfer. They provide valuable insights for policymakers involved in land transfer, enabling them to optimize policies and facilitate farmers' decision-making processes.

The blood brain barrier (BBB) is an essential component in regulating and maintaining the homeostatic microenvironment of the central nervous system (CNS). During the occurrence and development of glioblastoma (GBM), BBB is pathologically disrupted with markedly increased permeability. Due to the obstruction imposed by the BBB, strategies currently employed for GBM therapeutics still obtain a very low success rate and lead to systemic toxicity. Moreover, chemotherapy could promote pathological BBB functional restoration, accompanied with a prominent decrease of intracerebral therapeutics transportion during GBM multiple administration, resulting in chemotherapy failure for GBM treatment. The effective delivery of therapeutics into the brain still faces with severe challenges. Regulation of pathological BBB for enhanced transporting of therapeutics across the barrier may provide new opportunities for effective and safe treatment of GBM. This article reviews the structure and function of BBB in physiological state, the mechanisms underlying BBB pathological fenestration during the development of GBM, and the therapeutic strategies of GBM based on BBB intervention and therapeutic drugs transporting across the BBB.

Iron overnutrition has been implicated with higher risk of developing metabolic and cardiovascular diseases, including metabolic syndrome (MetS), while iron deficiency anemia exacerbates many underlying chronic conditions. Hemoglobin (Hb) concentration in the blood, which reflects a major functional iron (i.e., heme iron) in the body, may serve as a surrogate of iron nutrition status. We conducted sex-specific observational association studies where we carefully titrated the association between Hb deciles and MetS and its components among the Taiwanese Han Chinese (HC) from the Taiwan Biobank and Europeans of White ancestry from the UK Biobank, representing two large ethnicities. Our data show that at higher-than-normal levels of Hb, increasing deciles of Hb concentration were significantly associated with MetS across all sex subgroups in both ethnicities, with the highest deciles resulting in up to three times greater risks than the reference group [Taiwanese HC: OR=3.17 (95% CI, 2.75-3.67) for Hb >16.5 g/dL in men, OR=3.11 (2.78-3.47) for Hb >14.5 g/dL in women; European Whites: OR=1.89 (1.80-1.98) for Hb >16.24 g/dL in men, OR=2.35 (2.24-2.47) for Hb >14.68 g/dL in women]. The association between stronger risks and increasing Hb deciles was similarly observed with all metabolic components except diabetes. Here we found that both the highest Hb decile groups and contrarily the lowest ones, with respect to the reference, were associated with higher odds of diabetes in both ethnic groups [e.g., Taiwanese HC men: OR=1.64 (1.33-2.02) for Hb >16.5 g/dL, OR=1.71 (1.39-2.10) for Hb <13.5 g/dL; European Whites women: OR=1.39 (1.26-1.45) for Hb >14.68 g/dL, OR=1.81 (1.63-2.01) for Hb <12.39 g/dL]. These findings confirm that elevated Hb concentrations, a potential indicator of iron overnutrition, may play a role in the pathophysiology of MetS and metabolic components.

Background: With a rapid rise in our older adult population globally and due to their multimorbidities, our older adults are more likely to engage in the services provided in the emergency department at a higher rate than younger adults. The current emergency service delivery model may be ineffective against such an ageing phenomenon. Research reports most older adults having one or more co-morbidities including functional decline, dementia, and frailty. Studies have shown that older adults have been undertriaged with physicians not being able to comprehend their complex needs related to their presenting complaints in the emergency department. Geriatric emergency departments have incepted worldwide to better manage this care deficiency in the rapidly ageing society around the world. Data Sources: A search of published literature from 2010-2020 using (keywords) as described below was undertaken of which, relevant literature were selected for an informed review. Implications for Nursing: Understanding geriatric emergencies can enable healthcare workers to reduce undertriaging and provide appropriate care that improves patient's health outcomes currently and in the future in the emergency department. Further education in gerontology can also be a platform for our nurses to enhance their care and thought process, likewise upskilling themselves for the future geriatric population seeking treatment. Older healthcare workers will also be able to enhance their current job scope before retirement. In-house teachings from trained gerontologists or certified programs can shed light on the special care needs of our senior citizens globally. Conclusion: With our rapidly increasing population, we can expect an influx of our older patients both from home and long-term care facilities to present to the emergency department with a wide range of geriatric emergencies. By being able to create a geriatric screening process and tailored care models, healthcare workers will be able to understand their care process and in turn, improve patients' health outcomes and provide a quicker transition of care.

There is a noticeable absence of health education among college students. This study aimed to evaluate the extent of general nutrition knowledge among Chinese university students and explore its association with eating attitudes. Data were collected from a group of 273 students in Spring of 2023, using a valid and reliable research instrument consisting of three sections: demographic variables, the General Nutrition Knowledge Questionnaire (GNKQ), and the Eating Attitudes Test (EAT-26). The results were analyzed using SPSS, with correlations and t-tests to examine the relationships between nutritional knowledge and dietary attitudes. Furthermore, the present study employed the Random Forest (RF) algorithm, a machine learning technique, utilizing the Mean Decrease Impurity (MDI) method to investigate the influence of various features on participants' eating attitudes. The findings revealed that Chinese university students had an average accuracy of over 60% in their nutritional knowledge, but their understanding of the relationship between diet and disease still needs improvement. Moreover, male students had significantly lower nutritional knowledge than female students, and there was a positive correlation between nutritional knowledge and parents’ income. The study also found a significant correlation between the level of nutritional knowledge and eating attitudes. RF results indicated that family income level exhibited the most substantial impact on the eating attitudes of the participants. The study highlights the need for nutrition education curriculum developers to focus more on improving students' nutritional knowledge, with particular attention given to male students, low-income individuals, and those with an abnormal BMI.

An automated discharge imaging system (ADIS), a non-intrusive and safe approach, was developed for measuring river flows during flash flood events. ADIS consists of dual cameras to capture complete surface images in the near and far fields. Surface velocities are accurately measured using the Large Scale Particle Image Velocimetry (LSPIV) technique. The stream discharges are then obtained from the depth-averaged velocity (based upon an empirical velocity-index relationship) and cross-section area. The ADIS was deployed at the Yu-Feng gauging station in Shimen Reservoir upper catchment, northern Taiwan. For a rigorous validation, surface velocity measurements were conducted using ADIS/LSPIV and other instruments. In terms of the averaged surface velocity, all measured results were in good agreement with small differences, i.e., 0.004 to 0.39 m/s and 0.023 to 0.345 m/s when compared to those from acoustic Doppler current profiler (ADCP) and surface velocity radar (SVR), respectively. The ADIS/LSPIV was further applied to measure surface velocities and discharges during typhoon events (i.e., Chan-Hom, Soudelor, Goni, and Dujuan) in 2015. The measured water level and surface velocity both showed rapid increases due to flash floods. The estimated discharges from ADIS/LSPIV and ADCP were compared, presenting good consistency with correlation coefficient R = 0.996 and normalized root mean square error NRMSE = 7.96%. The results of sensitivity analysis indicate that components till (τ) and roll (θ) of the camera are most sensitive parameter to affect the surface velocity using ADIS/LSPIV. Overall, the ADIS based upon LSPIV technique effectively measures surface velocities for reliable estimations of river discharges during typhoon events.

China historically exhibits spatial differentiation from population distribution to ecological or economic development, and the forest pest control work is an epitome of this tendency. In recent times, global warming, man-made monoculture tree plantations, increasing human population density and intensified international trade aggravate forest pest outbreaks. Although Chinese government has complied with the internationally recommended practices, few stones remain unturned due to existing differential regional imbalance of forest pest distribution and control abilities. Evidence shows that the high-income provinces in the south have taken advantage of economic and technological superiority, resulting in the adoption of more efficient pest-control measures. To the contrary, in economically underdeveloped provinces of the northwest, a paucity of financial support has led to serious threats of pest damage that almost mirrored the demarcations of the Hu Huanyong Line. In this paper, we propose introducing public-private partnership (PPP) model into forest pest control and combining the national strategies to enact regional prevention measures in order to break the current spatially differentiated trends in China.

Facing with errors of a product after machining was a big title in this field. That will affect to product’s quality with unpredictable situation when products is in use for some particular application such as in medical facilities. Improving the precision of machine tools by exploring temperature on multiple points and measuring differential locations of the spindle is going to be executed in this study. A temperature measurement tool and a software running on Windows platform have been developed and combining with Non-bar system in order to support analyzing the temperature rising with the changes of length of the spindle to find the compensation solution based on eccentricity and length distortion. In this study, the whole tests have done on UX300 five – axis CNC machine tools for this investigation and the errors after applying compensation function have reduced 70% at least, with respect to the errors after machining without using compensation function.

The demand for industries to enhance sustainability is rising in response to climate change worries. A pervasive and intensifying worldwide environmental problem, plastic pollution has a particularly severe impact on climate change. The production of significant volumes of plastic garbage occurs mostly in Asian regions. So, it's commonplace to talk about pro-environmental conduct nowadays. Indonesia and Taiwan are chosen as case studies of developed and developing regions, respectively. The cultural differences between the two areas do, however, exist in terms of environmental values, and this further influences consumer behavior. In order to understand how environmental education has influenced pro-environmental behavior, this study examines how environmental attitude, knowledge, motivation, and intention have changed as a result of environmental education. By sending electronic questionnaires to a sample of 235 respondents (110 Indonesian and 125 Taiwanese), gathered between March 11 and April 30, 2023, we employ quantitative approaches and data-gathering procedures. The CB-Structural Equation Modelling with AMOS analytical tool is used to examine the data. We are able to draw important conclusions from the study of differences between Indonesian and Taiwanese and make suggestions for more research as well as theoretical and managerial ramifications.

Ensuring equal access to affordable higher education for women and men has become a crucial target of UNESCO’s SDG4-Education 2030. Currently, about one-third of the world's college-age population participates in higher education, while the gender disparity persists in various systems. This study employed GDP per capita, gross enrollment ratio (GER), and the gender parity index (GPI) to demonstrate how the education systems have expanded resulting in the transformation of gender parity. We selected Japan, Korea, Taiwan, and the UK as research targets using a cross-correlation function and trend analysis to detect concurrent relationships and future trends with GDP per capita, GER, and GPI. The findings suggest Japan, Korea, and the UK continue to show gender disparity and need to respond to this issue in their policy intervention for SDG4-Education 2030. The results reveal a potential problem in the UK when GPI growth might become unlimited with females dominated. This study suggests the higher education expansion phenomenon and gender diversity in mass and universal systems can be detected by the trend analysis with GDP per capita, GER, and GPI in different settings. The design of the study provides an example to explore the gender diversity patterns in higher education systems for sustainable development.

The lack of reliable rainfall projection records remains a major challenge to Uganda. In the advent of extreme wetness or drought events, reliable rainfall estimates for local planning and adaptation are essential. The present study used two main datasets to conduct a historical analysis from 1981 to 2019, coupled with future projections under representative concentration pathway (RCP 8.5) for the period 2020-2050. Historical analysis revealed bimodal annual rainfall pattern for March-May (MAM) and September-November (SON) gradients representing heavier to lighter rainfall events respectively over the study area. Investigation of recent trends in rainfall patterns revealed an upward trend from 2010 onwards in annual and seasonal rainfall. Moreover, results for future projections show wet conditions are projected to occur over the study area between the months of April/May and October. Contrarily, March is likely to experience a reduction in wet conditions. Mann-Kendall test employed to make future projections of rainfall depicted decreasing patterns during MAM season whilst increasing tendencies with strong shift was highlighted for SON season over the study region. Meanwhile, annual projections indicate huge variations with linear trends showing a marginal increase as compared to historical trends. Findings would serve as baseline print to propel further studies that could delve into impact analysis of drought extreme events which pose significant threats to the agricultural sector which is heavily reliant on rainfall.

Airborne distributed position and orientation system (ADPOS), which integrates multi-inertia measurement units(IMUs), data-processing computer and Global Navigation Satellite System (GNSS), serves as a key sensor in new higher-resolution airborne remote sensing, such as array SAR, multinode imaging loads and so on. ADPOS can provide multinode high accuracy spatio-temporal reference information to realize multinode motion compensation with the various state estimation methods such as Central Difference Kalman Filtering (CDKF), modifed CDKF. However, these methods focus on noise optimization based on known nonlinear models and its linear minimum variance estimation criterion, which cannot gain better estimation performance for high-dimensional nonlinear systems. For this reason, the variational optimization process based on conjugate gradient algorithm is proposed for the estimation of filtering update step, which is more efficient than linear minimum variance estimation criterion. Therefore, aiming at ADPOS with high-dimensional and nonlinearity, Central Difference Variational Filtering (CDVF) using variational optimization based on conjugate gradient algorithm for mean correction in the filtering update stage is devoted to advancing the estimation accuracy of multinode motion parameters. A real ADPOS flight test has been conducted, the experimental results show that the accuracy of the slave motion parameters has a distinct progress than the up to date CDKF, and the compensation performance is distinct.

Petri nets are a graphical notation for describing a class of discrete event dynamic systems whose behaviours are charaterised by concurrency, synchronisation, mutual exclusion and conflict. They have been used over the years for the modelling of various distributed systems applications. With the advent of pervasive systems and the Internet of Things, the Calculus of Context-aware Ambients (CCA) emerged as a suitable formal notation for analysing the behaviours of these systems. In this paper, we are interested in comparing the expressive power of Petri nets to that of CCA. That is, can the class of systems represented by Petri nets be modelled in CCA? To answer this question, an algorithm is proposed that maps any Petri net onto a CCA process. We show that a Petri net and its corresponding CCA process behave the same way through experiments. It follows that CCA is at least as expressive as Petri nets, i.e. any system that can be specified in Petri nets can also be specified in CCA. Moreover, tools developed for CCA can also be used to analyse Petri nets.

The Woka-Cuona rift zone, situated in the easternmost portion of southern Tibet, displays complex geological conditions. It consists of three distinct grabens or half grabens, spanning the Himalayan and Gangdese terranes from south to north. Examining the distribution patterns and genetic mechanism of the geothermal system in the Woka-Cuona rift zone holds significant guidance for studying the genetic mechanisms of geothermal systems and the production and utilization of ge-othermal resources in the rift zones of southern Tibet. Based on the geological conditions of the study area, the mechanism of rift formation and the distribution characteristics of geothermal water in the three distinct grabens were analyzed through data collection, ground surveys, geochemical analysis, and isotope analysis. Alongside topographic, drainage, and structural features, the Woka-Cuona rift zone was subdivided into four zones from north to south - Woka, Qiongduojiang, northern Cuona, and southern Cuona grabens. Additionally, the study investigated the geochemical char-acteristics, recharge sources, and water-rock interactions of geothermal water in different zones, providing a scientific foundation for subsequent geothermal energy production.

Single-layer core corrugated sandwich panels generally consist of a corrugated core and two layers of panels, while multi-layer core corrugated sandwich panels are formed by stacking multiple layers of panels with multiple layers of core layers. In this study, integrated multilayer core corrugated sandwich panels with different shapes of corrugated cores (triangular, trapezoidal, and rectangular) and the different number of core layers were fabricated using 3D printing technology, and the mechanical behavior of such multilayer core corrugated sandwich panels under quasi-static three-point bending was investigated using experiments and numerical simulations. The effects of core shape and number of core layers on the bending deformation process, damage mode, load carrying capacity, and bending energy dissipation capacity of multilayer core sandwich panels are discussed. Parametric design of multilayer triangular core corrugated sandwich panels was also carried out by finite element software ABAQUS. It was found that a new multilayer corrugated sandwich panel with a multi-layer core is better than the single core shape multilayer corrugated sandwich panel in terms of bending load capacity, energy dissipation capacity and deformation capacity can be obtained through the combination design of different core shapes.

Attracting and retaining international students has been widely discussed in higher education settings. Increasing the number of international students has become an indispensable strategy for national and global competition. This study focuses on effective strategies and international students' issues regarding satisfaction in the most popular STEM (science, technology, engineering, and mathematics) programs. We designed a structural equation modeling (SEM) method to determine the effect of institutional mediation between push factors and satisfaction factors for the development of better strategies by which to attract and retain international students. Taking Taiwan as an example, this study employed a self-designed questionnaire to collect data: 485 degree-seeking international students in STEM programs were invited and successfully participated in this study during spring 2021. IBM SPSS 26 and AMOS 26 (Analysis of Moment Structure) were used to carry out the data analysis. We employed reliability, factor, and SEM analyses. This study assumed that the impact of push factors can be modified by institutional situations and result in international students’ satisfaction with their learning and environment and regarding migration policy. The results revealed that the predictors, mediation, and criteria were significant at the 0.05 or 0.01 levels. The findings suggest that push factors impact international students’ satisfaction when using institutional leadership and international strategy. The results of the bootstrap with a generalized least square method showed that the SEM model fit in 2000 bootstrap samples. The effect of institutional mediation can provide useful information for STEM programs to boost their future recruitment and retention strategies. This study provides an innovative approach to the detection of issues among international students in specific programs. These findings can enrich our knowledge regarding attracting and retaining global students in higher education settings.

Plain lakes play a crucial role in the hydrological cycle of a watershed, but their interactions with adjacent rivers and downstream water bodies can create complex river-lake relationships, often leading to frequent flooding disasters. Taking Poyang Lake as an example, this paper delves into its interaction with the Yangtze River, revealing the spatiotemporal patterns of flood propagation within the lake and its impact on surrounding flood control measures. The aim is to provide insights for flood management in similar environments worldwide. This study employs a comprehensive approach combining hydrological statistical analysis and two-dimensional hydrodynamic modeling, based on extensive hydrological, topographic, and socio-economic data. The results indicate that the annual maximum outflow from Poyang Lake is primarily controlled by floods within the watershed, while the highest annual lake water level is predominantly influenced by floods from the Yangtze River. The peak discharge typically reaches the lake outlet within 48 hours, with the peak water level taking slightly longer at 54 hours. However, water storage in the lake can shorten the time for the peak discharge to arrive. When converging with floods from the Yangtze River, the peak water level may be delayed by up to 10 days due to the top-supporting interaction. Furthermore, floods from the "Five Rivers" propagate differently within the lake, affecting various lake regions to differing degrees. Notably, floods from the Fu River cause the most significant rise in lake water level under the same flow rate. The top-supporting effect from the Yangtze River also significantly impacts the water surface slope of Poyang Lake. When the Yangtze River flood discharge far exceeds that of the "Five Rivers" (i.e., when the top-supporting intensity f value exceeds 4), the lake surface becomes as flat as a reservoir. During major floods in the watershed, the water level difference in the lake can increase dramatically, potentially creating a "dynamic storage capacity" of up to 840 million cubic meters.

This study uses a mass-spring-damping system to simulate the repeated strain of liquefaction cyclic triaxial tests. The two results are compared in this paper to understand the feasibility of the mass-spring-damping system developed in this paper and the feasibility of future research on this related topic and development potential. The main factors affecting this mode's repeated strain are the spring coefficient k and the external force Q0. The spring coefficient has an inverse relationship but does not increase in multiples. The external force has a direct proportional relationship but does not increase the result- a non-multiple increase. When the pore water pressure of the liquefied cyclic triaxial test specimen rises, it will cause the specimen to liquefy, decreasing effective stress, shear modulus G, and damping ratio D, causing an increase in strain. The shear modulus and damping ratio are related to the spring coefficients k and c. Both are variables that change with time. This article takes an original thin-tube specimen at point A in the Yunlin area in Taiwan as a testing example. Through Mathematica software, it can be obtained that the mass m=1kg, the spring coefficient k=244e-0.1t kgf/cm, and the damping coefficient c=0.739e-0.257t kgf-s/cm and external force Q0=10.1sin2πt kg; Finally, this study selected the original thin-tube specimens from four locations in the Yunlin area, and simulated the repeated strain amount of the cyclic triaxial test specimens through a spring-damping system. The results show that the spring-damping system is feasible for simulated cyclic triaxial tests because the model is simple and the parameters are easy to understand and obtain, which also shows the extensibility of this model. Preliminary results of the research show that this model can further simulate the repeated strain obtained by cyclic triaxial tests without considering the increased trend in pore water pressure and the decrease in effective stress during cyclic loading.

Acute myeloid leukemia (AML) is a hematological malignancy that is the culmination of genetic and epigenetic alterations in the hematopoietic progenitor cells, leading to uncontrolled proliferation at the expense of normal hematopoiesis and bone marrow exhaustion. Although the outcomes for pediatric AML have improved in recent decades, at least one third of children still have relapses. Recent studies have notably highlighted the important role of dysregulated epi-genetic mechanisms in myeloid leukemogenesis. Epigenetic modifications are frequently reversible compared to genetic alterations, thus providing opportunities for targeted epigenetic therapy. In this review, we summarize the landscape of epigenetic alterations and the progress to date in epigenetic targeted therapy, and focus on the future role of epigenetic abnormalities in predicting relapse and the precision therapy in pediatric AML.

Construction using earth materials demonstrates ecological sustainability using locally sourced natural materials and environmentally friendly demolition methods. In this study, the environmental impact of adding cement to soil materials for rammed-earth farmhouse construction in rural China was investigated and comparatively simulated using the One Click LCA database, focusing on the conflict between sustainability objectives and the practical aspects of cement addition. By analyzing how the addition of cement aligns with local construction practices and by addressing the debate surrounding the inclusion of cement in rammed earth construction, our objective is to provide insights into achieving a balance between the environmental impact and the pragmatic considerations of using cement in earthen building practices. Three local structure scenarios are evaluated via simulations: a cement-stabilized rammed earth wall, a fired brick wall, and a localized reinforced concrete frame structure. The quantitative environmental impacts are assessed, and the qualitative differences in adaptation, economic sustainability, and other factors are examined in the context of present-day development in rural China. The results show that the use of cement-stabilized rammed earth wall-supported structures is associated with higher embodied carbon emissions compared to structures supported by reinforced concrete frames and enclosed by brick walls; however, these emissions are lower than those for brick wall-supported structures, while effectively meeting the structural requirements. In addition, the use of cement-stabilized earth for perimeter walls simplifies material management and disposal throughout the building's life cycle, and the cost-effectiveness of cement has been found to be substantially greater than that of reinforced concrete frames and brick structures, improving economic viability and social acceptability, especially among low-income communities in rural areas.

Let BT4l denotes a subclass of bounded turning functions connected with a four-leaf-type domain. The goal of the study is to probe into coefficients of |b6|, |b7|, |b8|, the bounds of the logarithmic coefficients and the third-order determinants of H3,1, H3,2, H3,3 for functions in this class.

Uchino first initiated the study of generalized Reynolds operators on associative algebras. Recently, related research has become a hot topic. In this paper, we first introduce the notion of generalized Reynolds operators on Hom-Lie triple systems associated to a representation and a 3-cocycle. Then, we develop cohomology of generalized Reynolds operators on Hom-Lie triple systems with coefficients in a suitable representation. As applications, we use the first cohomology group to classify linear deformations and we study the obstruction class of an extendable order $n$ deformation. Finally, we introduce and investigate Hom-NS-Lie triple system as the underlying structure of generalized Reynolds operators on Hom-Lie triple systems.

The meshless Petrov-Galerkin (MLPG) method is developed to analyse 2-D problems for flexoelectricity and thermoelectricity. Both problems are multiphysical and scale dependent. The size-effect is considered by the strain- and electric field-gradients in the flexoelecricity and higher-grade heat flux in the thermoelectricity. The variational principle is applied to de-rive the governing equations considered constitutive equations. The order of derivatives in governing equations is higher than in equations obtained from classical theory. The coupled governing partial differential equations (PDE) are satisfied in a local weak-form on small fic-titious subdomains with a simple test function. Physical fields are approximated by the mov-ing least-squares (MLS) scheme. Applying the spatial approximations in local integral equa-tions a system of algebraic is obtained for the nodal unknowns.

Visual-inertial integrated navigation system (VINS) has been extensively studied over the past decades to provide accurate and low-cost positioning solutions for autonomous systems. Satisfactory performance can be obtained in an ideal scenario with sufficient and static environment features. However, there are usually numerous dynamic objects in deep urban areas, and these moving objects can severely distort the feature tracking process which is fatal to the feature-based VINS. The well-known method mitigates the effects of dynamic objects is to detect the vehicles using deep neural networks and remove the features belongs to the surrounding vehicle. However, excessive exclusion of features can severely distort the geometry of feature distribution, leading to limited visual measurements. Instead of directly eliminating the features from dynamic objects, this paper proposes to adopt the visual measurement model based on the quality of feature tracking to improve the performance of VINS. Firstly, a self-tuning covariance estimation approach is proposed to model the uncertainty of each feature measurements by integrating two parts: 1) the geometry of feature distribution (GFD), 2) the quality of feature tracking. Secondly, an adaptive M-estimator is proposed to correct the measurement residual model to further mitigate the impacts of outlier measurements, such as the dynamic features. Different from the conventional M-estimator, the proposed method effectively alleviates the reliance of excessive parameterization of M-estimator. Experiments are conducted in a typical urban area of Hong Kong with numerous dynamic objects, and the results show that the proposed method could effectively mitigate the effects of dynamic objects and improved accuracy of VINS is obtained when compared with the conventional method.

Topology optimization is a pioneering design method that can provide various candidates with high mechanical properties. However, the high-resolution for the optimum structures is highly desired, normally in turn leading to computationally intractable puzzle, especially for the famous Solid Isotropic Material with Penalization (SIMP) method. In this paper, an efficient and high-resolution topology optimization method is proposed based on the Super-Resolution Convolutional Neural Network (SRCNN) technique in the framework of SIMP. The SRCNN includes four processes, i.e. refining, path extraction & representation, non-linear mapping, and reconstruction. The high computational efficiency is achieved by a pooling strategy, which can balance the number of finite element analysis (FEA) and the output mesh in optimization process. To further reduce the high computational cost of 3D topology optimization problems, a combined treatment method using 2D SRCNN is built as another speeding-up strategy. A number of typical examples justify that the high-resolution topology optimization method adopting SRCNN has excellent applicability and high efficiency for 2D and 3D problems with arbitrary boundary conditions, any design domain shape, and varied load.

Privacy and information insurance have consistently been a priority for the European Union lawmaker. This paper presents whether the NIS prevails in its underlying endeavors to remain the congruity among residents and companies. It distinguishes current difficulties that specific business structures may experience while conforming to the Regulation. The exploration traces certain reasons which could impede the opportune reception of the new lawful ideas inside the system of the organizations. The exploration incorporates what is unique about the NIS; how it overlaps with existing frameworks; and how security requirements in the GDPR influence the NIS Directive. This paper furnishes different point of views of experts with the aim of setting up an entire examination

Oral cancer ranks sixth among Taiwan's top 10 cancers, and most patients with poor prognosis acquire metastases. The essential fatty acid alpha-linolenic acid (ALA) has been found to diminish many cancer properties. However, the anti-cancer activity of ALA in oral cancer has yet to be determined. Migration and invasion assays confirmed OSCC cells' EMT capabilities, whereas flow cytometry and Western blotting identified the molecular pathways. ALA dramatically reduced cell growth in a concentration dependent manner, according to the findings. Low concentrations of ALA (100 or 200 μM) inhibit colony formation, expression of Twist and EMT-related proteins, expression of MMP2/-9 proteins and enzyme activity, as well as cell migration and invasion. Treatment with high concentrations of ALA (200 or 400 μM) greatly increases JNK phosphorylation and c-jun nuclear accumulation, then upregulates the FasL/caspase8/caspase3 and Bid/cytochrome c/caspase9/caspase3 pathways, leading to cell death. Low concentrations of ALA inhibit SAS and GNM cell migration and invasion by suppressing Twist and downregulating EMT-related proteins, or by decreasing the protein expression and enzyme activity of MMP-2/-9, whereas high concentrations of ALA promote apoptosis by activating the JNK/FasL/caspase 8/caspase 3-extrinsic pathway and the Bid/cytochrome c/caspase 9 pathway. ALA demonstrates potential as a treatment for OSCC patients.

This paper considers the Hermitian solutions of a new system of commutative quaternion matrix equations, we establish both necessary and sufficient conditions for the existence of solutions. Furthermore, we derive an explicit general expression when it is solvable. To illustrate our main findings, we present two numerical algorithms and examples in this paper.

To have a better protection, strong toughness and good flexibility, all lives and plants must have skins, similarly, all books should have covers. In this paper, considering interlayer friction as a perturbation, we formulate a hardcover-book-like laminated plates with internal friction. For a quasi-static problem, detail analysis on the bending response and energy dissipation are carried out for a three-point-supported plates. Our numerical investigations show that the hardcover is more essential than the core layers in terms of bending response, and the energy dissipation within per loading-unloading cycle can be made to vary by a considerable amount. The central goal of studying is not only to predict the bending deformation of the book-like-plates, but also as a representative case to help finding some clue on the universal behaviours of multilayered architectures with internal friction.

Cold chain logistics of Agricultural Products demand forecasting can provide the scientific basis for the country to formulate logistics strategy, which further promotes the development of social economy and the improvement of living standards in China. In this paper, a new mathematical combined model is proposed to Agricultural Products Demand. Shandong, one of a China’s province, serves as the main producer and distributor of agricultural products. Based on the index system created from multiple related factors influencing cold chain logistics demand of agricultural products in Shandong, this paper employs principal component analysis to reduce the dimension of various indexes and predicts principal components with time series. Thereafter, multiple linear regression model and neural network model were constructed to forecast the cold chain logistics demand of agricultural products in Shandong, and their combined forecast models were compared. What's more, the paper provides insight for reference and decision-making concerning the development of cold chain logistics industry of agricultural products in Shandong province.

In this study, cement is used as the component that provides the stabilizing effect in order to evaluate the hardness and stability of loess soil. To assess the strength characteristics of loess soil reinforced with cement, samples were created with four different cement contents and three different curing times. The materials were put through a series of tests to determine their flexural strength, direct shear strength, indirect tensile strength, and unconfined compressive strength. An appropriate cement dosage was found, in addition to a durability index that could be used to quantify the effect of water absorption investigations on cement-stabilized loess. Both of these discoveries were made simultaneously. Analyses of investigations such as scanning electron microscopy (SEM) and energy dispersive X-ray fluorescence spectrometry (XRF) examinations were carried out so that the fundamental mechanics of the materials could be comprehended. According to the findings, the cohesion of cement-stabilized loess is significantly more sensitive to structure than the friction angle of the material, and the cohesion is responsible for the increase in shear strength after remolding. To get the desired level of strength, it is necessary to adjust the cement's proportions. In addition, as the curing period progresses, we see an increase in the cement-stabilized loess's resistance and stiffness. This is because of the interactions that take place between the structure and the mineral composition. It is believed that this event was caused by the cementation that occurs naturally. As a consequence of this reaction, the production of new cementitious materials takes place. The cation exchange that causes the hydration and pozzolanic reaction that leads to the creation of aggregates and interparticle flocculation is responsible for their production. These findings suggest that cement may be utilized as a simple and effective method of loess stabilization, which will ultimately result in improved performance of the loess.

In recent years, the rapid development of computer-aided planning and design technology has provided a new perspective for the study of complex problems such as the generation of architectural complex forms. This study focuses on how to apply parameterization technology to analyze and articulate traditional spatial form composition rules, aiming to minimize reliance on subjective human judgment in the protection and renewal design of the historical style of traditional villages. It aims to establish digital generative design tools to address the challenges of accurately inheriting and innovatively utilizing historical and cultural information in traditional settlements. It introduces how to rely on parameterization technology to analyze the spatial form composition rules, parameter extraction rules, and spatial reconstruction rules of traditional villages, facilitating the complete process from spatial features to parameterization rules, and then to the application of computational methods to deduce spatial features. It also includes case studies demonstrating the application of parameterization technology tools for village protection and explores the role of generative design tools in preserving the spatial style of these settlements.

Both bacteria product flagellin and macrophages are implicated in HIV infection/disease progression. However, the impact of their interaction on HIV infection and the associated mechanisms remain to be determined. We thus examined the effect of the flagellins on HIV infection of primary human macrophages. We observed that the pretreatment of macrophages with the flagellins from the different bacteria significantly inhibited HIV infection. The mechanistic investigation showed that the flagellin treatment of macrophages downregulated the major HIV entry receptors (CD4 and CCR5) and upregulated the CC chemokines (MIP-1α, MIP-1β, and RANTES), the ligands of CCR5. These effects of the flagellin could be compromised by a toll like receptor 5 (TLR5) antagonist. Given the important role of flagellin as a vaccine adjuvant in TLR5 activation-mediated immune regulation and in HIV infection of macrophages, future investigations are necessary to determine the in vivo impact of flagellin-TLR5 interaction on macrophage-mediated innate immunity against HIV infection and the effectiveness of flagellin adjuvant-based vaccines studies.

A typhoon-induced storm surge is considered one of the most severe coastal disasters in Taiwan. However, the combination of the storm surge and the astronomical tide called the storm tide can actually cause extreme flooding in coastal areas. This study implemented a two-dimensional hydrodynamic model to account for the interaction between tides and storm surges on the coast of Taiwan. The model was validated with observed water levels at Sauo Fish Port, Hualien Port, and Chenggong Fish Port under different historical typhoon events. The model results are in reasonable agreement with the measured data. The validated model was then used to evaluate the effects of the typhoon's intensity, bathymetric change, and the combination of the typhoon’s intensity and bathymetric change on the maximum storm tide and its distribution along the east coast of Taiwan. The results indicated that the maximum storm tide rises to 1.92 m under a typhoon with an intensity of a 100-year return period. The maximum storm tide increased from a baseline of 1.26 m to 2.63 m for a 90% bathymetric rise at Sauo Fish Port under the conditions of Typhoon Jangmi (2008). The combination of the intensity of a typhoon with a 100-year return period and a 90% bathymetric rise will result in a maximum storm tide exceeding 4 m, 2 m, and 3 m at Sauo Fish Port, Hualien Port, and Chenggong Fish Port, respectively. We also found that the distribution of the maximum storm tide on the east coast of Taiwan can expand significantly subject to the bathymetric rise.

To promote low-carbon and green travel, this study proposes a tripartite evolutionary game model among new energy vehicle manufacturers, consumers, and government agencies. The game strategy combinations of each party and the stability conditions of the equilibrium point in the evolutionary game system are analyzed, and the validity of the conclusions is verified through simulation results. The study shows a strong correlation between the three parties in the evolutionary game system. From the perspective of car manufacturers, the probability of producing new energy vehicles is positively proportional to the subsidy received from new energy policy, the additional revenue gained from the management of the carbon trading scheme, and the fine received for producing conventional fuel vehicles. However, from the consumer perspective, the likelihood that consumers purchase new energy vehicles is positively related to the utility value to consumers and the coverage of public charging points in the city, and inversely related to the sales price of new energy vehicles. From the government perspective, a combination of direct subsidy policies and indirect support strategies should be considered to stimulate the rapid development of the new energy vehicle industry.

Lymphoma diagnoses in the U.S. are substantial, with an estimated 89,380 new cases in 2023, necessitating innovative treatment approaches. Phase 1 clinical trials play a pivotal role in this context. We developed a binary predictive model to assess trial adherence to expected average durations, analyzing 1,089 completed Phase 1 lymphoma trials from clinicaltrials.gov. Using machine learning, the Random Forest model demonstrated high efficacy with an accuracy of 0.7248 and ROC-AUC of 0.7701 for lymphoma trials. Importantly, this model maintained an accuracy of 0.7405 when applied to lung cancer trials, showcasing its versatility. A key insight is the correlation between higher predicted probabilities and extended trial durations, offering nuanced insights beyond binary predictions. Our research contributes to enhanced clinical research planning and potential improvements in patient outcomes in oncology.

Dual quaternions have wide applications in automatic differentiation, computer graphics, mechanics and others. Due to its application in control theory, the matrix equation AXB=C has been extensively studied. However, there is currently limited information on matrix equation AXB=C over the dual quaternion algebra. In this paper, we provide the necessary and sufficient conditions for the solvability of the dual quaternion matrix equation AXB=C, and present the expression for the general solution when it is solvable. As an application, we derive the ϕ-Hermitian solutions for the dual quaternion matrix equation AXAϕ=C, where the ϕ-Hermitian extends the concepts of Hermiticity and η-Hermiticity. Lastly, we present a numerical example to verify the main research results of this paper.

This study aims to develop novel automated computer vision algorithms and systems for component replacement inspection for Printed Circuit Boards (PCBs). The proposed algorithms are able to identify locations as well as sizes of different components. They are object detection algorithms based on keypoints of the target components. The algorithms can be implemented as neural networks consisting of two portions: frontend networks and backend networks. The frontend networks are used for the feature extractions of input images. The backend networks are adopted for producing component inspection results. Each component class can has its own frontend and backend networks. In this way, the neural model for the component class can be effectively reused for different PCBs. To reduce the computation time for the inference of the networks, different component classes can share the same frontend networks. A two-stage training process is proposed for effectively exploring features of different components for accurate component inspection. The proposed algorithm has the advantages of the simplicity for training data collection, high accuracy for defect detection, and high reusability and flexibility for online inspection. The algorithm is an effective alternative for the automated inspection in smart factory with growing demand for product quality and diversification.

High-resolution (2 km) high-frequency (hourly) SST data from 2015-2020 provided by the Advanced Himawari Imager (AHI) onboard the Japanese Himawari-8 geostationary satellite positioned over 140.7°E were used to study spatial and temporal variability of the China Coastal Front (CCF) in the East China Sea. The hourly SST data were processed with the Belkin and O’Reilly (2009) algorithm to generate long-term mean monthly maps of SST gradient magnitude (GM) and frontal frequency (FM) using a GM threshold of 0.1°C/km. Horizontal structure of SST field in the vicinity of the CCF was investigated from cross-frontal distributions of SST along 8 parallels from 31°N to 24°N. The high resolution (2 km) monthly distributions of SST along these 8 parallels were used to determine inshore and offshore boundaries of the CCF and calculate the CCF strength defined as the total cross-frontal SST step dSST=Offshore SST – Inshore SST. The CCF emerges in November, fully develops in December and peaks in strength in January-February. The front’s fragmentation and shrinking/weakening begins in February and March, respectively. In winter (December-February), the front’s strength dSST exceeds 5°C offshore the Zhejiang-Fujian coast and could be as high as 7.5°C when nearshore waters cool down to 7°C. In winter, the front’s strength decreases downstream from 31°N to 24°N. The CCF changes its physical nature as the seasons progress. In winter, the CCF is a water mass front between cold and fresh water coming from the north and warm and salty water coming from the south. In summer, the CCF becomes a coastal upwelling front maintained largely by southerly winds. In winter, the CCF’s cross-frontal structure in the SST field is ramp-shaped, with SST increasing monotonously in the offshore direction. In summer, the CCF’s cross-frontal structure in the SST field is V-shaped or U-shaped, featuring a minimum SST formed by cold upwelled water at some distance from the shore. Thus, the summer SST structure effectively consists of two fronts, a nearshore and offshore, with a minimum SST in-between. Across the inshore/offshore front, the SST decreases/increases in the offshore direction. The local bathymetry, especially the relatively steep shelf slope between 20-m and 50-m isobath, steers the front, which does not meander in winter offshore the Zhejiang-Fujian coast. As the cold season progresses, the front’s axis gradually shifts into deeper waters, from ~20 m to ~50 m.

Ankylosing spondylitis (AS) is a chronic inflammatory disorder with unknown etiology and hard to early diagnose. It’s imperative to investigate the changes in AS patients’ peripheral blood, which may contribute to the diagnosis and further understanding of AS. Common differential expressed genes between normal and AS patients in GSE73754 and GSE25101 were screened by machine learning algorithms. IL2RB and ZDHHC18 were hubgenes screened and a diagnostic model was established. C-indexes and calibration analyses suggested high prediction accuracy of the model in training and validation cohorts. The AUC values of the model in GSE73754, GSE25101, GSE18781 and GSE11886 were 0.86, 0.84, 0.85 and 0.89 respectively. Decision curve analyses suggested high net benefit by the model. Functional analysis of the differential expressed genes indicated that they were mainly clustered in processes related to immune response. Immune microenvironment analysis revealed that neutrophils were expanded and activated in AS, while some T cells were decreased. IL2RB and ZDHHC18 were potential blood biomarkers for AS and might be used for early diagnosis and a supplementary diagnostic tool to the existing methods. Our study deepened the insight into the pathogenesis of AS.

To date, viral RNA detection is almost the only way to confirm SARS-CoV-2infectionin practice.However, variousreasons can cause low sensitivity for RNA detection, and thisposes aserious challenge to disease control. We tested the performance of detecting total antibody(Ab) and IgM levels in serum by the methods of chemiluminescence, enzyme-linked immunosorbent assay (ELISA), and colloidal golddetection. The datashowed that the sensitivity and specificity for detecting total Ab and IgM levels were high by all three methods, and the sensitivity was higher for detecting total Ab than for detecting IgM. Evidence from studieshas shown thatviral RNA testingcombinedwith serological testing could increase the diagnostic sensitivity while maintaining a high specificity. Specific serology testsfor SARS-CoV-2 havegreat value for clinical practice and public health.

The framework of product life cycle (PLC) cost analysis is one of the most important evaluation tools for a contemporary high-tech company in an increasingly competitive market environment. The PLC-purchasing strategy provides the framework for a procurement plan and examines the sourcing strategy of a firm. The marketing literature emphasizes that ongoing technological change and shortened life cycles are important elements in commercial organizations. From a strategic viewpoint, the vendor has an important position between supplier, buyer and manufacturer. The buyer seeks to procure the products from a set of vendors to take advantage of economies of scale and to exploit opportunities for strategic relationships. However, previous studies have seldom considered vendor selection (VS) based on PLC cost (VSPLCC) analysis. The purpose of this paper is to solve the VSPLCC problems considering the situation of a single-buyer-multiple-supplier. For this issue, a new VSPLCC procurement model and solution procedure are derived by this paper to minimize net cost, rejection rate, late delivery and PLC cost subject to vendor capacities and budget constraints. Moreover, a real case in Taiwan is provided to show how to solve the VSPLCC procurement problem.

The airport ground handling service (AGHS) equipment vendor selection (AGHSEVS) problem is critical for ramp work safety management, because AGHS equipment malfunctions affect airport ramp work safety. Appropriate vendor selection can prevent aircraft damage and delays in airlines schedules, and ensure reliable and high-quality ground handling service. The AGHSEVS problem is a time-consuming and complex process that requires professional knowledge and experience to make judgments. Specifically, AGHSEVS is a multi-criteria decision-making (MCDM) problem. Previous research has seldom integrated MCDM methods with linear and goal programming to solve the AGHSEVS problem. The objective of this study was to develop a new system evaluation model for AGHSEVS by considering both qualitative and quantitative methods. We test the proposed approach on an AGHS company in Taiwan.

A new optical steganography scheme is proposed that transmits a stealth optical code-division multiple-access (OCDMA) signal through a public binary phase-shift keying (BPSK) channel. Polarization beam splitters and arrayed waveguide gratings are used to implement a spectral-polarization coding (SPC) system with an incoherent optical source. We employ a Walsh–Hadamard code as the signature code of the user who wants to transmit stealth information using the system. A free space optical link applied to this system maintains the polarization states of light during propagation. The secret data is extracted using correlation detection and balanced subtraction in the OCDMA decoder of the intended receiver, and the other signal from the public channel is reduced by the OCDMA decoder. At the demodulator of the public channel, BPSK demodulation eliminates the stealth signal so that the public channel is not affected by the stealth signal. The two signals cannot interfere with each other. The results of this study show that our proposed optical steganography system is highly secure. The stealth signal can be favorably hidden in the public channel when the average source power of the stealth signal, public noise, and public signal are −5, −3, and 0 dBm, respectively.