For improving the tracking accuracy and model switching speed of maneuvering target tracking in nonlinear systems, a new algorithm named interacting multiple model fifth-degree spherical simplex-radial cubature filter (IMM5thSSRCKF) is proposed in this paper. The new algorithm is a combination of the interacting multiple model (IMM) filter and fifth-degree spherical simplex-radial cubature filter (5thSSRCKF). The proposed algorithm makes use of Markov process to describe the switching probability among the models, and uses 5thSSRCKF to deal with the state estimation of each model. The 5thSSRCKF is an improved filter algorithm, which utilizes the fifth-degree spherical simplex-radial rule to improve the filtering accuracy. Finally, the tracking performance of the IMM5thSSRCKF is evaluated by simulation in a typical maneuvering target tracking scenario. Simulation results show that the proposed algorithm has better tracking performance and quicker model switching speed when disposing maneuver models compared with IMMUKF, IMMCKF and IMM5thCKF.

Taiwan developing offshore wind power to promote green energy and self-electricity production. In this study, a Light Detection and Ranging (Lidar) was set up at Chang-Hua development zone one on the sea and 10km away from the seashore. At Lidar location, WRF (3.33km & 2km grid lengths) model and WAsP were used to simulate the wind speed at various elevations. Three days mean wind speed of simulated results were compared with Lidar data. From the four wind data sets, developed five different comparisons to find an error% and R-Squared values. Comparison between WAsP and Floating Lidar was shown good consistency. Lukang meteorological station 10 years wind observations at 5m height were used for wind farm energy predictions. The yearly variation of energy predictions of traditional and TGC wind farm layouts are compared under purely neutral and stable condition. The one-year cycle average surface heat flux over the Taiwan Strait is negative (-72.5 (W/m2) and 157.13 STD), which represents stable condition. At stable condition TGC (92.39%) and 600(92.44%), wind farms were shown higher efficiency. The Fuhai met mast wind data was used to estimate roughness length and power law exponent. The average roughness lengths are very small and unstable atmosphere.

The adaptive identification method developed to evaluate the parameters of the Bouc-Wen hysteresis (BWH). The adaptive approach based on the use of adaptive observers. We synthesize adaptive identification algorithms using the second Lyapunov method. The boundedness of adaptive system processes shown in coordinate and parametric spaces. We prove exponential dissipativity of processes in an adaptive system. Estimating method proposed for signaling uncertainty in the system.

Avian infectious bronchitis virus (IBV) is the causative agent of infectious bronchitis, which causes considerable economic losses to the poultry industry worldwide. It is imperative to develop safe and efficient candidate vaccines to control IBV infection. In the current study, recombinant baculoviruses co-expressing S1 and N proteins, mono-expressing S1 or N proteins alone of IBV were constructed and prepared into subunit vaccines rHBM-S1-N, rHBM-S1 and rHBM-N. The levels of immune protection of these subunit vaccines were evaluated by inoculating specific pathogen-free (SPF) chickens at 14 days of age, boosting with the same dose 14 days later, and following challenge with a virulent GX-YL5 strain of IBV 14 days post-booster (dpb). The commercial vaccine strain H120 was used as a control. The IBV-specific antibody levels as well as the percentages of CD4+ and CD8+ T lymphocytes were detected within 28 days post-vaccination (dpv). The morbidity, mortality, and re-isolation of virus from the tracheas and kidneys of challenged birds were evaluated at 5 days post-challenge (dpc). The results showed that the IBV-specific antibody levels and the percentages of CD4+ and CD8+ T lymphocyte in rHBM-S1-N group were higher than those of rHBM-S1 and rHBM-N groups, especially the cellular immunity response. At 5 dpc, the mortality, morbidity and virus re-isolation rate of rHBM-S1-N were slightly higher than those of H120 group, but were lower than those of rHBM-S1 group and rHBM-N group. The present study demonstrated that the protection of recombinant baculovirus co-expressing S1 and N proteins was better than that of recombinant baculoviruses mono-expressing S1 or N protein alone. Thus, the recombinant baculovirus co-expressing S1 and N proteins could serve as a potential IBV vaccine and this demonstrates that the bivalent subunit vaccine including the S1 and N proteins might be a strategy for the development of an IBV subunit vaccine.

It is well known that human activities and climate change have increased steppe habitat loss and fragmentation in Northwest China. Carabid beetles are often used as bioindicators of environmental change because they are extremely sensitive to disturbance. We chose 42 landscapes (18 fragmented and 24 continuous) in both desert and typical steppes of Northwest China to examine the influence of habitat loss and fragmentation on carabid beetle communities. The results showed the largest correlation coefficient between carabid communities and landscape compositions within a 7-km spatial scale in both desert and typical steppes. Further, the response of carabid communities to habitat fragmentation was species-specific in both desert and typical steppes. Habitat fragmentation in the desert steppe had positive effects on the richness and abundance of carabid communities, while in the typical steppe, the effects were negative. Additionally, habitat fragmentation significantly decreased the abundance of two common carabid species in the desert steppe. Therefore, the effects of habitat fragmentation on carabid biodiversity differ with species characteristics and habitat traits, where plant communities, soil structure, and microclimate vary in the different steppe types. The results of this study provide experimental evidence and technical support for biodiversity conservation management in the steppes of Northwest China.

Neuronal cells are believed to rely on autophagy to maintain cellular homeostasis. Nevertheless, autophagy may be a therapeutic target for neurodegenerative diseases because of the role it plays in neuronal cell death. Despite Beclin 1 association with autophagy and apoptosis, the molecular mechanisms that underlie Tau-induced vesicular pathology and Tau protein aggregates in humans remain poorly understood. Here, we set out to examine the role of three genes-ATG14L, Beclin 1 and VPS34- in autophagy nucleation failure-associated Tau disorders in fruit fly models. We found that either reduced ATG14L levels improve neuronal outcomes, or transgenic expression of ATG6/Beclin 1 greatly reduced age-dependent neurodegeneration and Tau pathology; whereas, the loss of Beclin 1 exacerbated these effects. Prior to p-Tau accumulation, the neuronal Beclin 1 network is critical for reducing p-Tau accumulation, indicating that the loss of Beclin 1 causes Tau pathology and neurodegeneration. As neurodegeneration progressed, glial cells showed an upregulation of vesicular Beclin 1 immunoreactivities. The reduced VPS34 also resulted in p-Tau accumulation, suggesting that neurons require both Beclin 1 and VPS34 to reduce p-Tau accumulation. Our results provide mechanistic insight into the molecular pathways that cause age-dependent Tau pathology and neurodegeneration due to an excess of autophagy nucleation processes and autophagy activity, and we derive novel inferences on the therapeutic possibilities of rebalanced Beclin 1 network by reducing autophagic specific nucleation component of ATG14L.

Fully mechanized mining face production involves complex geological conditions; mining pressure; gas, water, fire and other mining environments. The working face needs a shearer, hydraulic support, a scraper conveyor and other equipment for coordination. The deep integration of intelligent technology with factors such as "humans, machines, the environment, and management" in the workplace is the core content of intelligent coal mines. This paper puts forward an advanced framework for coal mining robot technology systems, including single robots, robotized equipment, robot clusters and unmanned systems. The framework clarifies the common key technologies of coal mining robot research and development and cross-integration with new technologies such as 5G, the industrial internet, big data, artificial intelligence, and digital twins to improve the autonomous and intelligent application of coal mining robots. By establishing a scientific and complete standard system for coal mining robots, we aim to achieve customized research and development and standardized production of various types of robots. A specific analysis was conducted on the research progress of common key technologies such as explosion-proof design, mechanical system innovation, power drive, intelligent sensing, positioning and navigation, and underground communication of coal mining robots. The current research and application status of various types of coal mining robots in China are summarized. A new direction for future coal mine robot research and development is proposed. Moreover, robotic mining systems should be promoted to enhance the overall intelligence level and mining efficiency of mining equipment. To develop human‒machine environment-integrated robots to improve the autonomy and collaboration level of coal mining robots. The digital twinning of the entire mine robot system should be accelerated, the normalized operation level of coal mine robots should be improved, research on coal mining robots, support robots, and transportation robots should be carried out, intelligence should be achieved in fully mechanized mining faces, and equipment support for fewer and unmanned fully mechanized mining faces should be provided. The practical process of implementing coal mining robotization has been summarized, and the technical and engineering feasibility of the coal mining machine population has been verified.

Developing clinically meaningful nanomedicines for cancer therapy requires the drugs to be effective, safe, simple, cheap, and easy to store. In the present work, we report that a simple cationic Fe(III)-rich salt of [FeIIICl(TMPPH2)][FeIIICl4]2 (Fe-TMPP) exhibits a superior anticancer performance toward a broad spectrum of cancer cell lines, including breast, colorectal cancer, liver, pancreatic, prostate, and gastric cancers, with half maximal inhibitory concentration (IC50) values in the range of 0.098−3.97 μM (0.066−2.68 μg mL−1), and comparable to the best-reported medicines. Fe-TMPP can forms stand-alone nanoparticles in water without the need for extra surface modification or organic-solvent-assisted antisolvent precipitation. Critically, Fe-TMPP is TME-responsive (TME = tumor microenvironment), and can only elicit its function in the TME with overexpressed H2O2, converting H2O2 to the cytotoxic •OH to oxidize the phospholipid of the cancer cell membrane, causing ferroptosis, a programmed cell death process of cancer cells.

The newly emerged severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) has infected millions of people and caused tremendous morbidity and mortality worldwide. Effective treatment for coronavirus disease 2019 (COVID-19) due to SARS-CoV-2 infection is lacking and different therapeutic strategies are under testing. Host humoral and cellular immunity to SARS-CoV-2 infection is a critical determinant for patients’ outcome. SARS-CoV-2 infection results in seroconversion and production of anti-SARS-CoV-2 antibodies. The antibodies may suppress viral replication through neutralization but also might also participate in COVID-19 pathogenesis through a process termed antibody-dependent enhancement. Rapid progress has been made in the research of antibody response and therapy in COVID-19 patients including characterization of the clinical features of antibody responses in different populations infected by SARS-CoV-2, treatment of COVID-19 patients with convalescent plasma and intravenous immunoglobin products, isolation and characterization of a large panel of monoclonal neutralizing antibodies, as well as preliminary clinical results from several COVID-19 vaccine candidates. In this review, we summarize the recent progress and discuss the implications of these findings in vaccine development.

Federated learning trains a neural network model using the client's data to maintain the benefits of centralized model training, while maintaining the privacy. However, if the client data are not independently and identically distributed (non-IID) because of different environments, the accuracy of the model may suffer from client drift during training owing to discrepancies in each client's data. This study proposes a personalized federated learning algorithm based on the concept of multitask learning to divide each client model into two layers: a feature extraction layer and a category prediction layer. The feature extraction layer maps the input data to a low-dimensional feature vector space. Furthermore, the parameters of the neural network are aggregated with those of other clients using an adaptive method. The category prediction layer maps low-dimensional feature vectors to the label sample space, with its parameters remaining unaffected by other clients to maintain client uniqueness. The proposed personalized federated learning method produces faster learning model convergence rates and higher accuracy rates for the non-IID datasets in our experiments.

The increased consumption of high fat-containing foods has been linked to the prevalence of obesity and abnormal metabolic syndromes. Rhizopus oligosporus, a fungus in the family Mucoraceae, is widely used as a starter for homemade tempeh. Although R. oligosporus can prevent the growth of other microorganisms, it grows well with lactic acid bacteria (LAB). Lactobacillus plantarum can produce β-glucosidase, which catalyzes the hydrolysis of glucoside isoflavones into aglycones (with greater bioavailability). Therefore, the development of a soybean-based functional food by the co-inoculation of R. oligosporus and L. plantarum is a promising approach to increase the bioactivity of tempeh. In this study, the ameliorative effect of L. plantarum in soy tempeh on abnormal carbohydrate metabolism in high-fat diet (HFD)-induced hyperglycemic rats was evaluated. The co-incubation of L. plantarum with R. oligosporus during soy tempeh fermentation reduced the homeostatic model assessment of insulin resistance, HbA1c, serum glucose, total cholesterol, triglyceride, free fatty acid, insulin, and low-density lipoprotein contents and significantly increased the high-density lipoprotein content in HFD rats. It also increased the LAB counts as well as the bile acid, cholesterol, triglyceride, and short-chain fatty acid contents in the feces of HFD rats. Our results suggested that the modulation of serum glucose and lipid levels by LAB occurs via alterations in the internal microbiota, leading to the inhibition of cholesterol synthesis and promotion of lipolysis. Tempeh, produced with both L. plantarum and R. oligosporus, may be a beneficial dietary supplement for individuals with abnormal carbohydrate metabolism.

Theories of reading comprehension emphasize decoding and listening comprehension as two essential components. The current study aimed to investigate how Chinese character decoding and context-driven auditory semantic integration contribute to reading comprehension in Chinese middle school students. Seventy-five middle school students were tested. Context-driven auditory semantic integration was assessed with speech-in-noise tests in which the fundamental frequency (F0) contours of spoken sentences were either kept natural or acoustically flattened with the latter requiring a higher degree of contextual information. Statistical modelling with hierarchical regression was conducted to examine the contributions of Chinese character decoding and context-driven auditory semantic integration to reading comprehension. Performance on Chinese character decoding and auditory semantic integration scores with the flattened (but not natural) F0 sentences significantly predicted reading comprehension. Furthermore, the contributions of these two factors to reading comprehension were better fitted with an additive model instead of a multiplicative model. These findings indicate that reading comprehension in middle schoolers is associated with not only character decoding but also the listening ability to make better use of the sentential context for semantic integration in a severely degraded speech-in-noise condition. The results add to our better understanding of the multi-faceted reading comprehension in children. Future research could further address the age-dependent development and maturation of reading skills by examining and controlling other important cognitive variables, and apply neuroimaging techniques such as functional magmatic resonance imaging to reveal the neural substrates for the contribution of auditory semantic integration and the observed additive model to reading comprehension.

Considering that consumers are more willing to buy products online, companies are increasingly selling remanufactured products online through e-commerce platforms. Notwithstanding the high attention it elicits from researchers and companies, the study about the remanufacturing trading platform is in its infancy. Thus, we investigate 20 remanufacturing trading platforms related nowadays and make a gap analysis among them in terms of: (i) business model, (ii) product display, (iii) delivery products, (iv) quality assurance and after-sales service, (v) product review and star rate and (vi) transaction and payment. On this basis, we analyze features and trends for the development of remanufacturing trading platforms and propose six key applications aimed at filling the identified gaps. The consortium blockchain has the characteristics of security and transparency, high credibility, traceability and unfalsifiability, low cost, and strong scalability, which can provide effective support for the six key applications. Then, we construct the technical framework and the model of a consortium blockchain-supported remanufacturing trading platform. Further, we analyze the coupling mechanism between consortium blockchain and remanufacturing trading platform to explain how the remanufacturing trading platform supported by consortium blockchain achieves development characteristics. This study provides important guidance for the development, construction, and operation management of remanufacturing trading platforms.

Terrestrial plant resources are becoming increasingly scarce; moreover, the development of science and technology has facilitated the exploration of marine ecosystems. We isolated and identified six novel (1–6) and six (7–12) known secondary metabolites of Alternaria sp MCCC 3A00467 by chromatographic and spectroscopic techniques and investigated their antitumor activities in human myeloma (U266), liver cancer (HepG2), and lung cancer (A549) cells by the MTT assay. Among these compounds, the new compounds 2, 3 and 4 exhibited excellent anticancer activities with IC₅₀ values of 21.98, 24.99 and 14.78 μg/mL, respectively. These compounds obtained from a marine source have the potential to be developed into novel anticancer drugs.

In recent years, various optical measurement technologies such as far-infrared spectroscopy, low-frequency Raman spectroscopy, optical Kerr effect spectroscopy, and two-dimensional Raman-terahertz spectroscopy have developed vigorously. By comparing the complementary aspects detected by various linear and nonlinear spectroscopic techniques, a coherent picture emerges from studies of dynamics in water. Numerous molecular dynamics experiments and theoretical investigations have demonstrated low-frequency molecular motions in liquid water. For example, intermolecular hydrogen bond vibration, molecular reorientation motion, and the interaction between molecule/ionic solute and hydrogen bond all occur in the THz region, which are closely related to their physical/chemical properties and structural dynamics. However, precise probing of various modes of motion is difficult due to the complexity of the collective and cooperative motion of molecules and the spectral overlap of related modes. With the development of THz optical technology, current state-of-the-art THz sources can generate pulsed electric fields with peak intensities on the order of ~MV/cm. Such strong fields make it possible to use THz waves as the driving light source for nonlinear polarization of the medium, which in turn leads to the development of the emerging terahertz Kerr effect (TKE) spectroscopy technique. Many low-frequency molecular motion modes, such as the collective directional motion of molecules and the cooperative motion under the constraint of weak intermolecular interactions, are resonantly excited to unprecedentedly strong amplitudes driven by the THz electric field. Thereby the collected responses are increased. The TKE technique thus creates an interesting prospect for investigating low-frequency dynamics in these media. In view of this, this paper firstly summarizes the research work on the measurement mechanism of TKE spectroscopy by taking the solid material without low-frequency molecular dynamics process as an example. Starting from the principle of TKE technology and the exploration of the properties of solid matter using this technology, its application in the exploration of low-frequency molecular dynamics of liquid water and aqueous solutions is introduced. Liquid water is considered the building block of life and possesses many extraordinary physical and biochemical properties. Its hydrogen bonding network plays a crucial role in these properties. It is generally believed that the ability of water to form complex hydrogen-bonding networks is the main reason for its various kinetic and thermodynamic properties that are different from other liquids. However, the exact structure of the hydrogen-bonding network, the spatial extent of its existence, and the associated timescale are not known. And the relevant spectral information of the basic properties of the reaction water is still not known. Therefore, it is of great significance to evaluate the hydrogen bond-related kinetic properties of liquid water by optical means.

This study proposes a new algorithm termed rain cell identification and tracking (RCIT) to identify and track rain cells from high resolution weather radar data. Previous algorithms have limitations when tracking non-consequent rain cells owing to their use of maximum correlation coefficient methods and their lack of an alternative way to handle the variation stages of rain cells during their life cycles. To address these deficiencies, various methods are implemented in the new algorithm. These include the particle image velocimetry (PIV) method for motion estimation and the rain cell matching rule to obtain the stage changes of rain cells. High resolution (5-min and 1-km) radar reflectivity data from three rainy days over the German federal state North Rhine Westphalia (NRW) are used to evaluate the proposed algorithm. The performance of the new algorithm is compared with a radar reflectivity map and verified by two object-oriented methods: structure–amplitude–location (SAL) and geometric index. The verification results suggest that the performance of the new algorithm is good. Application of the RCIT algorithm to the selected cases shows that the inner structure of rainfall events in the experimental region present extreme value distributions, with most rainfall events having a short duration with less intensity. The new algorithm can effectively capture the stage changes of rain cells during their life cycles. The proposed algorithm can serve as the basis for further hydro-meteorological applications such as spatial and temporal analysis of rainfall events and short-term flood forecasting.

Cold stress is a major environmental factor affecting the growth, development, and productivity of various crop species. With the current trajectory of global climate change, low temperatures are becoming more frequent and can significantly decrease crop yield. Wheat (Triticum aestivum L.) is the first crop to be domesticated and is the most popular cereal crop in the world. Due to a lack of systematic research on cold response pathways and gene regulatory networks, the underlying molecular mechanisms of cold signal transduction in wheat are poorly understood. This study reviews recent progress in wheat, including the ICE-CBF-COR signaling pathway in cold stress and the effects of cold stress on hormonal pathways, reactive oxygen species (ROS), and epigenetic regulation. This review also highlights outstanding issues that are crucial for understanding the interactions between wheat and low-temperature conditions.

Under the "dual carbon" target in China, virtual power plants (VPPs) play an important role in improving grid security and promoting clean and low-carbon energy transformation. VPPs can integrate and control distributed resources to participate in the energy market and make full use of distributed resources. However, the intermittency and volatility of renewable energy and the "heat-driven" working mode of CHP units create contradictions that seriously affect the peak-shaving ability of VPPs and lead to high carbon emissions. To solve these problems, this paper aggregates CHP units, wind power, photovoltaics, carbon capture, hydrogen energy storage, and electric boilers into a new type of virtual power plant. The "hydrogen energy storage-electric boiler" joint decoupling CHP working mode is used to strengthen the coupling relationship between electric-thermal-hydrogen load. At the same time, a tiered carbon trading mechanism is considered, with the net profit of the VPP as the optimization objective, balancing economic and environmental considerations. A low-carbon economic dispatch model for VPPs is established, and a genetic algorithm is used for optimization. Three different scheduling strategies are set, and simulations are conducted in three different seasonal scenarios. The results show that the net profit in the cooling season increased by 50.4%, and carbon emissions decreased by 42.3%. In the transitional season, the net profit increased by 39.2%, and carbon emissions decreased by 44.9%. In the heating season, the net profit increased by 19.4%, and carbon emissions decreased by 43.4%. Overall, the proposed dispatch strategy can improve the new energy consumption capacity and total revenue of VPPs while achieving the goal of reducing carbon emissions.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

With the fast development of the mobile Internet, the online platforms of social networks have rapidly been developing for the purpose of making friends, sharing information, etc. In these online platforms, users being related to each other forms social networks. Literature reviews have shown that social networks have community structure. Through the studies of community structure, the characteristics and functions of networks structure and the dynamical evolution mechanism of networks can be used for predicting user behaviours and controlling information dissemination. Therefore, this study proposes a deep community detection method which includes (1) matrix reconstruction method, (2) spatial feature extraction method and (3) community detection method. The original adjacency matrix in social network is reconstructed based on the opinion leader and nearer neighbors for obtaining spatial proximity matrix. The spatial eigenvector of reconstructed adjacency matrix can be extracted by an auto-encoder based on convolution neural network for the improvement of modularity. In experiments, four open datasets of practical social networks were selected to evaluate the proposed method, and the experimental results show that the proposed deep community detection method obtained higher modularity than other methods. Therefore, the proposed deep community detection method can effectively detect high quality communities in social networks.

This study proposes a mobile positioning method which adopts recurrent neural network algorithms to analyze the received signal strength indications from heterogeneous networks (e.g., cellular networks and Wi-Fi networks) for estimating the locations of mobile statioThis study proposes a mobile positioning method which adopts recurrent neural network algorithms to analyze the received signal strength indications from heterogeneous networks (e.g., cellular networks and Wi-Fi networks) for estimating the locations of mobile stations. The recurrent neural networks with multiple consecutive timestamps can be applied to extract the features of time series data for the improvement of location estimation. In practical experimental environments, there are 4,525 records, 59 different base stations, and 582 different Wi-Fi access points detected in Fuzhou University in China. The lower location errors can be obtained by the recurrent neural networks with multiple consecutive timestamps (e.g., 2 timestamps and 3 timestamps); the experimental results can be observed that the average error of location estimation was 9.19 meters by the proposed mobile positioning method with 2 timestamps.

Video editing is a high-required job, for it requires skilled artists or workers equipped with plentiful physical strength and multidisciplinary knowledge, such as cinematography, aesthetics. Thus gradually, more and more researches focus on proposing semi-automatical and even fully automatical solutions to reduce workloads. Since those conventional methods are usually designed to follow some simple guidelines, they lack flexibility and capability to learn complex ones. Fortunately, the advances of computer vision and machine learning make up the shortages of traditional approaches and make AI editing feasible. There is no survey to conclude those emerging researches yet. This paper summaries the development history of automatic video editing, and especially the applications of AI in partial and full workflows. We emphasizes video editing and discuss related works from multiple aspects: modality, type of input videos, methology, optimization, dataset, and evaluation metric. Besides, we also summarize the progresses in image editing domain, i.e., style transferring, retargeting, and colorization, and seek for the possibility to transfer those techniques to video domain. Finally, we give a brief conclusion about this survey and explore some open problems.

We introduce a series of twisted donor-acceptor (D-A) carbazole-benzophenone based electroactive bipolar derivatives that were synthesized through the reaction of 4-fluorobenzophenone with various partially alkylated 3,3’-bicarbazoles. The comprehensive structural characterization of these compounds is provided. These amorphous materials exhibit suitable glass transition temperatures ranging from 57 to 102 °C and demonstrate high thermal stability, with decomposition temperatures reaching 400 °C. Moreover, the developed materials exhibit elevated photoluminescence quantum yields (PLQY) of up to 75.5% and favorable HOMO-LUMO levels, along with suitable triplet-singlet state energy values. Due to their good solubility and suitable film-forming properties, all the compounds were evaluated as blue emitters dispersed in 4,4’-bis(N-carbazolyl)-1,10-biphenyl (CBP) host for the fabrication of organic light-emitting diodes (OLEDs) in concentration dependent experiments. Among these experiments, the device containing 15 wt% of the guest 4-(9’-{2-ethylhexyl}-[3,3’]-bicarbazol-9-yl)benzophenone demonstrated the best characteristics, achieving maximum brightness of 3581 cd/m2, current efficiency of 5.7 cd/A, power efficiency of 4.1 lm/W and external quantum efficiency of 2.7%.

Quantum coherence is an important physical resource in quantum information science, and also as one of the most fundamental and striking features in quantum physics. In this paper, we obtain a symmetry-like relation of relative entropy measure $C_r(\rho)$ of coherence for $n$-partite quantum states $\rho$, which gives lower and upper bounds for $C_r(\rho)$. Meanwhile, we discuss the conjecture about the validity of the inequality $C_r(\rho)\leq C_{\ell_1}(\rho)$ for any state $\rho$. We observe that every mixture $\eta$ of a state $\rho$ satisfying $C_r(\rho)\leq C_{\ell_1}(\rho)$ and any incoherent state $\sigma$ also satisfies the conjecture. We also note that if the von Neumann entropy is defined by the natural logarithm $\ln$ instead of $\log_2$, then the reduced relative entropy measure of coherence $\bar{C}_r(\rho)=-\rho_{\rm{diag}}\ln \rho_{\rm{diag}}+\rho\ln \rho$ satisfies the inequality ${\bar{C}}_r(\rho)\leq C_{\ell_1}(\rho)$ for any mixed state $\rho$.

Coronavirus disease 2019 (COVID-19) from severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection has resulted in tremendous morbidity and mortality worldwide. A major underlying cause of COVID-19 mortality is a hyperinflammatory cytokine storm in severe/critically ill patients. Although many clinical trials are testing the efficacy of targeting inflammatory cytokines/chemokines in COVID-19 patients, the critical inflammatory mediator initiating COVID-19 patient death is undefined. Here we suggest that the immunopathological pathway leading to COVID-19 mortality can be divided into three stages with distinct clinical features that can be used to guide therapeutic strategies. Our interpretation of the recently published clinical trials from COVID-19 patients suggests that the clinical efficacy in preventing COVID-19 mortality using IL-1 blockade is subjected to notable caveats, while that for IL-6 blockade is suboptimal. We discuss critical factors in determining appropriate inflammatory cytokine/chemokine targets, timing, and combination of treatments to prevent COVID-19 mortality.

This paper considers the Hermitian solutions of a new system of commutative quaternion matrix equations, we establish both necessary and sufficient conditions for the existence of solutions. Furthermore, we derive an explicit general expression when it is solvable. To illustrate our main findings, we present two numerical algorithms and examples in this paper.

The blood brain barrier (BBB) is an essential component in regulating and maintaining the homeostatic microenvironment of the central nervous system (CNS). During the occurrence and development of glioblastoma (GBM), BBB is pathologically disrupted with markedly increased permeability. Due to the obstruction imposed by the BBB, strategies currently employed for GBM therapeutics still obtain a very low success rate and lead to systemic toxicity. Moreover, chemotherapy could promote pathological BBB functional restoration, accompanied with a prominent decrease of intracerebral therapeutics transportion during GBM multiple administration, resulting in chemotherapy failure for GBM treatment. The effective delivery of therapeutics into the brain still faces with severe challenges. Regulation of pathological BBB for enhanced transporting of therapeutics across the barrier may provide new opportunities for effective and safe treatment of GBM. This article reviews the structure and function of BBB in physiological state, the mechanisms underlying BBB pathological fenestration during the development of GBM, and the therapeutic strategies of GBM based on BBB intervention and therapeutic drugs transporting across the BBB.

Objectives: Although pitch reception poses a great challenge for individuals with cochlear implants (CIs), formal auditory training (e.g., high variability phonetic training, HVPT) has been shown to provide direct benefits in pitch-related perceptual performances such as lexical tone recognition for CI users. As lexical tones in spoken language are expressed with a multitude of distinct spectral, temporal, and intensity cues, it is important to determine the sources of training benefits for CI users. The purpose of the present study was to conduct a rigorous fine-scale evaluation with the categorical perception (CP) paradigm to control the acoustic parameters and test the efficacy and sustainability of HVPT for Mandarin-speaking pediatric CI recipients. The main hypothesis was that HVPT-induced perceptual learning would greatly enhance CI users’ ability to extract the primary pitch contours from spoken words for lexical tone identification and discrimination. Furthermore, individual differences in immediate and long-term gains from training would likely be attributable to baseline performance and duration of CI use. Design: Twenty-eight prelingually deaf Mandarin-speaking kindergarteners with CIs were tested. Half of them received five sessions of HVPT within a period of three weeks. The other half served as control who did not receive the formal training. Two classical CP tasks on a tonal continuum from Mandarin Tone 1 (high-flat in pitch) to Tone 2 (mid-rising in pitch) with fixed acoustic features of duration and intensity were administered before (pretest), immediately after (posttest), and 10 weeks post training termination (follow-up test). Participants were instructed to either label a speech stimulus along the continuum (i.e., identification task) or determine whether a pair of stimuli separated by zero or two steps from the continuum was the same or different (i.e., discrimination task). Identification function measures (i.e., boundary position and boundary width) and discrimination function scores (i.e., between-category score, within-category score, and peakedness score) were assessed for each child participant across the three test sessions.Results: Linear mixed-effects (LME) models showed significant training-induced enhancement in lexical tone categorization with significantly narrower boundary width and better between-category discrimination in the immediate posttest over pretest for the trainees. Furthermore, training-induced gains were reliably retained in the follow-up test 10 weeks after training. By contrast, no significant changes were found in the control group across sessions. Regression analysis confirmed that baseline performance (i.e., boundary width in the pretest session) and duration of CI use were significant predictors for the magnitude of training-induced benefits. Conclusions: The stringent CP tests with synthesized stimuli that excluded acoustic cues other than the pitch contour and were never used in training showed strong evidence for the efficacy of HVPT in yielding immediate and sustained improvement in lexical tone categorization for Mandarin-speaking children with CIs. The training results and individual differences have remarkable implications for developing personalized computer-based short-term HVPT protocols that may have sustainable long-term benefits for aural rehabilitation in this clinical population.

This study aimed to investigate the relationship between sleep duration, dementia severity, age, and ANS regulation. This cross-sectional pilot study included 27 older patients with probable Alzheimer’s disease, hospitalized at a psychiatric center. We measured heart rate variability to assess ANS regulation at night, evaluated dementia severity using the Clinical Dementia Rating scale, and obtained sleep duration data from sleep diaries maintained by psychiatric nurses. The data were analyzed using repeated-measures generalized linear models with age, sex, dementia severity, and medication (antipsychotics) as covariates. A sleep duration of 7–8 h per night was associated with better ANS regulation than other sleep durations, as indicated by sympathovagal balance (p = 0.005). ANS dysregulation was characterized by a 20.7% increase in sympathetic nervous system activity and a 14.8% decrease in parasympathetic nervous system (PSNS) activity. We found a significant correlation between dementia severity and PSNS activity (p = 0.04) and observed an inverted U-shaped association between sleep duration and ANS regulation. This pilot study demonstrated that a sleep duration of 7–8 h per night may be critical in maintaining optimal ANS regulation. Bidirectional associations between sleep duration, inadequate sleep duration, aging, and ANS regulation warrant further investigation.

This paper investigates the problem of the optimal arrangement for both UAVs’ caching contents and service locations in UAV-assisted networks based on the context awareness, which considers the influence between users and environment. In the existing work, users within the coverage of UAVs are considered to be served perfectly, which ignores the communication probability caused by line-of-sight (LOS) and non- line-of-sight (NLOS) links. However, the links are related to UAV deployment. Moreover, the transmission overhead should be taken into account. To balance the tradeoff between these two factors, we design the ratio of users’ probability and transmission overhead as the performance measure mechanism to evaluate the performance of UAV-assisted networks. Then, we formulate the objective for maximizing the performance of UAV-assisted networks as a UAV-assisted caching game. It is proved that the game is an exact potential game with the performance of UAV-assisted networks serving as the potential function. Next, we propose the log-linear caching algorithm (LCA) to achieve the Nash equilibrium (NE). Finally, related simulation results reflect the great performance of the proposed algorithm.

Objective: Identify factors associated with excessive day time sleepiness (EDS) in individuals with obstructive sleep apnea (OSA), and analyze the effects that obesity and gender have on excessive daytime sleepiness in such individuals. Methods: A total of 160 people were selected for this study. All the people have completed a clinical evaluation, and whose apnea-hypopnea index (AHI) > 10 events/hour of sleep on polysomnography were included in the study from the Department of otolaryngology. Results: The Mean age was 43.87±11.34 years, mean EDS score was 14.09± 4.91, and mean AHI was 43.88±20.66 events/hour of sleep. Male presented lower mean age, higher EDS scores, and more time in apnoea, whereas females presented with higher mean age, lower EDS scores, and less time in sleep apnea. The EDS score showed best correlation with duration of apnoea (r = 0.448; p < 0.01), peripheral oxygen saturation (SpO₂; r = -0.458; p < 0.01) and AHI (r = 0.484; p < 0.01). The mean body mass index (BMI) was 27.41±3.86 kg/m². Normal, Overweight, obese, and morbidly obese were observed in 20%, 61%, 18%, and 0.6% of cases, respectively. Severity of the disease best correlated with BMI (r = 0.421; p < 0.01). Conclusions: OSA is predominant in males (M/F 5:1), and obese population. Females diagnosed with OSA have higher mean age. However, EDS scores and time spent in sleep apnoea is lower in females. Higher BMI is associated with EDS, irrespective of gender.

Strawberry root rot caused by Neopestalotiopsis clavispora is one of the main diseases of strawberry and significantly impacts the yield and quality of strawberry fruit. There are now no effective control techniques available except for fungicide sprays, which may directly impact consumers. Biological control is becoming an alternative method for the control of plant diseases to replace or decrease the application of traditional synthetic chemical fungicides. Trichoderma is widely used as a biological agent for controlling strawberry root rot. In order to provide resources for screening the highly effective biocontrol fungus for controlling strawberry root rot caused by Neopestalotiopsis clavispora, the biocontrol mechanism,the control effects of Trichoderma asperellum CMT10 against strawberry root rot and growth-promoting effects on strawberry seedlings were investigated by plate culture, microscopy observation and root drenching methods.The results showed that CMT10 had obvious competitive, antibiotic and hyperparasitism effects on Neopestalotiopsis clavispora CMGF3. The CMT10 could quickly occupy nutritional space, and the inhibition rates of CMT10 against CMGF3 in confrontation culture on 7 d was 65.49%. The inhibition rates of volatile metabolite and fermentation metabolite produced by CMT10 against CMGF3 were 79.67% and 69.84%, respectively. The mycelium of strain CMT10 can act as hyperparasites by making contacting, winding and penetrating hyphae of CMGF3. Pot experiment showed that the biocontrol efficacy of CMT10 on strawberry root rot caused by Neopestalotiopsis clavispora was 63.00%. CMT10 had obvious promotion effect on strawberry growth, the plant height, root length, total fresh weight, root fresh weight, stem fresh weight and root dry weight, with the promotion rates were 20.09%, 22.39%, 87.11%, 101.58%, 79.82% and 72.33%, respectively. Overall, this study showed the ability of Trichoderma asperellum CMT10 to control strawberry root rot and their potential to develop as novel biocontrol agents to replace chemical fungicides for eco-friendly, sustainable agriculture.

With the development of nuclear technology application, radiation safety has been widely concerned, and there is an urgent need for novel shielding materials. Among the various options available, non-lead organic composite shielding material has emerged as a promising solution in the field of radiation shielding due to its high strength, easy processing, and light weight. In this study, tungsten/epoxy resin (W/EP) composite samples with tungsten weight fraction from 0% to 60% were prepared. The shielding and mechanical properties of W/EP composites were investigated. The results show that the results showed that the higher the tungsten content, the greater the shielding capacity of W/EP composites, particularly for low-energy gamma ray (γ) shielding. However, the addition of tungsten reduces the impact strength and tensile properties of the material. Overall, for 300 keV γ-ray, W/EP with 30% tungsten content has comparable shielding capacity to ordinary concrete. W/EP composite materials can serve as shielding materials for low-energy γ-rays.

Purpose: School-age children with autism spectrum conditions (ASC) often experience difficulties in speech-in-noise (SiN) perception, leading to increased listening effort that impacts their well-being and academic performance. This study aimed to investigate the SiN processing challenges faced by Mandarin-speaking children with ASC and its impact on their listening effort. Methods: Participants completed sentence recognition tests in both quiet and noisy conditions, with a steady-state noise masker presented at 0 dB signal-to-noise ratio in the noisy condition. We compared recognition accuracy and task-evoked pupil responses from 23 Mandarin-speaking children with ASC to 19 age-matched neurotypical (NT) counterparts to gauge their behavioral performance and listening effort during these auditory tasks. Results: The ASC group demonstrated notably decreased accuracy in noise compared to their NT peers, suggesting poorer SiN perception. Pupillometric data further revealed significantly larger peak dilations in the ASC group than in the NT group under comparable conditions. Importantly, the ASC group's peak dilation in quiet mirrored the NT group's in noise. However, the ASC group exhibited shorter peak latencies and reduced mean dilations than the NT group in similar conditions. Such patterns indicate the ASC group might initially experience a heightened cognitive load but utilize fewer cognitive resources as the task continued, indicating an atypical allocation of cognitive resources and a potential tendency towards relatively superficial and automated auditory processing. Conclusion: Our findings highlight the unique SiN processing challenges children with ASC face, underscoring the importance of a nuanced, individual-centric approach for interventions and support.

Anthracnose is one of primary diseases in tea plants that affects tea yield and quality. The geographical distribution, occurrence regularity, and agronomic measures of tea plants with anthracnose have been researched for decades. However, the pathogenic cause of anthracnose in tea plants is diverse in different regions of the world. Identifying the specific pathogenic fungi causing tea anthracnose is an essential control measure to mitigate this disease. In this study, 88 Diaporthales and 45 Colletotrichum isolates were obtained from 3 different types of diseased tea leaves. Based on multilocus phylogenetic and morphological analysis, 3 known species, including Discula theae-sinensis, Diaporthe ueckerae, Diaporthe lithocarpus, and 3 indistinguishable species of Diaporthales were identified. In adddition, 8 known species of Colletotrichum, C. fructicola, C. camelliae, C. aenigma, C. siamense, C. henanense, C. karstii, C. tropicicola, C. gigasporum, were identified. This study is the first to report C. tropicicola and C. gigasporum in tea plant in China. Discula theae-sinensis was the most common species in this study and caused disease lesions around wounded areas of tea leaves. The dual trials in vitro indicated Discula theae-sinensis and Colletotrichum were slight inhibition. Co-inoculating Discula theae-sinensis and C. fructicola was superior to single inoculation at low concentration.

Airborne distributed position and orientation system (ADPOS), which integrates multi-inertia measurement units(IMUs), data-processing computer and Global Navigation Satellite System (GNSS), serves as a key sensor in new higher-resolution airborne remote sensing, such as array SAR, multinode imaging loads and so on. ADPOS can provide multinode high accuracy spatio-temporal reference information to realize multinode motion compensation with the various state estimation methods such as Central Difference Kalman Filtering (CDKF), modifed CDKF. However, these methods focus on noise optimization based on known nonlinear models and its linear minimum variance estimation criterion, which cannot gain better estimation performance for high-dimensional nonlinear systems. For this reason, the variational optimization process based on conjugate gradient algorithm is proposed for the estimation of filtering update step, which is more efficient than linear minimum variance estimation criterion. Therefore, aiming at ADPOS with high-dimensional and nonlinearity, Central Difference Variational Filtering (CDVF) using variational optimization based on conjugate gradient algorithm for mean correction in the filtering update stage is devoted to advancing the estimation accuracy of multinode motion parameters. A real ADPOS flight test has been conducted, the experimental results show that the accuracy of the slave motion parameters has a distinct progress than the up to date CDKF, and the compensation performance is distinct.

The Woka-Cuona rift zone, situated in the easternmost portion of southern Tibet, displays complex geological conditions. It consists of three distinct grabens or half grabens, spanning the Himalayan and Gangdese terranes from south to north. Examining the distribution patterns and genetic mechanism of the geothermal system in the Woka-Cuona rift zone holds significant guidance for studying the genetic mechanisms of geothermal systems and the production and utilization of ge-othermal resources in the rift zones of southern Tibet. Based on the geological conditions of the study area, the mechanism of rift formation and the distribution characteristics of geothermal water in the three distinct grabens were analyzed through data collection, ground surveys, geochemical analysis, and isotope analysis. Alongside topographic, drainage, and structural features, the Woka-Cuona rift zone was subdivided into four zones from north to south - Woka, Qiongduojiang, northern Cuona, and southern Cuona grabens. Additionally, the study investigated the geochemical char-acteristics, recharge sources, and water-rock interactions of geothermal water in different zones, providing a scientific foundation for subsequent geothermal energy production.

Plants significantly shape root-associated microbiota, making rhizosphere microbes useful environmental indicator organisms for safety assessment. Here, we report the pyrosequencing of the bacterial 16S ribosomal RNA in rhizosphere soil samples collected from transgenic cry1Ab/cry1Ac Bt rice Huahui No. 1 (GM crop) and its parental counterpart, Minghui63. We identified a total of 2,579 quantifiable bacterial operational taxonomic units (OTUs). Many treatment-enriched microbial OTUs were identified, including 14 NonGM-enriched OTUs and 10 GM-enriched OTUs. The rhizosphere microbiota communities were influenced more strongly by growth in the field than by rice varieties. Furthermore, Huahui No. 1 transgenic Bt rice had a greater impact on the rhizosphere bacterial communities than Minghui63. Early developmental stages of the transgenic Bt rice had a significant impact on many Bacillaceae communities. While soil chemical properties were not significantly altered by the presence of transgenic Bt rice, we found peak expression level of Bt proteins during the seedling stage, which may be an intriguing factor for bacterial diversity variations. Based on these findings, we conclude that transgenic Bt rice has a significant impact on root-associated bacteria. This information may be leveraged in future environmental safety assessments of transgenic Bt rice varieties.

(1) Background: The elderly who have chewing difficulty (CD) are prone to malnutrition, frail-ty, and sarcopenia, and those with insufficient physical activity (IPA) are also prone to frailty, overweight, and high blood cholesterol. There is an urgent need to prepare functional foods and to promote healthy physical activity for the elderly over 70 years of age to prevent poor nutri-tion and frailty. (2) Methods: This study prepared functional foods (FF) with softened chicken moose and milkfish without fin for the elderly and compared the different effects of FF from those of music aerobic exercise (MAE) on the complete blood counts, blood biochemistry, in-cluding nutrition index of albumin, and cholesterol levels, and frailty scores before and after in-stitution of FF and MAE among residents of long-term care institutes. (3) Results: The FF signif-icantly increased the high-density lipoprotein cholesterol and albumin levels. In contrast, MAE significantly increased red blood cells (RBC), and decreased the rates of frailty items on fatigue feeling and low physical activity. In comparison between FF and MAE groups, we found that the FF for 5 weeks significantly improved better on HDL-C and MCV while the MAE for 10 weeks improved significantly better on hematopoiesis as increases in red blood cells and platelets. (4) Conclusions: Results from this study suggest that FF and MAE for the elderly have different ef-fects on nutrition status, blood biochemistry and frailty. A combination of both FF and MAE might provide better benefits of nutrition status, physical function, and frailty for the elderly.

14-Deoxy-11,12-didehydroandrographolide (deAND), a diterpenoid in Andrographis paniculata (Burm. f.) Nees, acts as a bioactive phytonutrient that can treat many diseases. To investigate the protective effects of deAND on reducing fatty liver disease, male mice were fed a high-fat and high-cholesterol (HFHC) diet without or with 0.05% and 0.1% deAND supplementation. Cholesterol accumulation, antioxidant and anti-inflammatory activities in liver and liver injury were evaluated after deAND treatment. The results show that deAND treatment for 7 weeks reduced plasma alanine aminotransferase activity and lowered hepatic cholesterol accumulation, tumor nuclear factor-α, and histological lesions. 0.1% deAND treatment reduced HFHC diet-induced apoptosis by lowering the caspase 3/pro-caspase 3 ratio. After 11-weeks of deAND treatment, increased NOD-like receptor protein 3 (NLRP3), capase-1, and interleukin-1β protein levels in liver were suppressed by deAND treatment. In addition, nuclear factor erythroid 2-related factor 2 (Nrf2) mRNA expression, heme oxygenase-1 protein expression, and the activities of glutathione peroxidase and glutathione reductase were increased in mice fed the HFHC diet. However, those activities of antioxidant enzymes or proteins were also upregulated by 0.1% deAND treatment. Furthermore, deAND treatment tended to lower hepatic lipid peroxides. Finally, deAND treatment reversed the depletion of hepatic glutamate level induced by HFHC diet. These results indicate that deAND may ameliorate HFHC diet-induced steatohepatitis and liver injury by increasing antioxidant and anti-inflammatory activities.

Cooperative Non-Orthogonal Multiple Access (NOMA) with Simultaneous Wireless Information and Power Transfer (SWIPT) communication can effectively improve the spectrum efficiency and energy efficiency of the wireless networks with extend coverage. An important design issue is to incentivize a relaying center user to participate in the cooperative process and achieve a win-win situation to both the BS and the center user. Some private information of the center users are hidden from the BS in the networks. We apply a contract theory-based incentive mechanism under such asymmetric information scenario to incentives center user to join the cooperative communication to maximize the BS profit utility and to guarantee the center user’s expect payoff. A match theory-based Gale-Shapley algorithm is proposed to obtain the optimal strategy with low computation complexity. Simulation results indicated the network performance of our proposed cooperative transmission is much better than the conventional NOMA transmission and the benefit utility of the BS with the stable match strategy is nearly close to the complete channel state information multi-users scenario while the center users get the satisfied expect payoffs.

Plant endophytic fungi and rhizosphere soil fungi are often reported as biocontrol agents against plant pathogens or with plant growth promotion potential. Four treatments were performed in field and greenhouse experiments where cucumber plants were inoculated with Trichoderma harzianum and Fusarium oxysporum in 2022. The roots, stems and leaves of cucumber plants and their rhizosphere soil were collected twice individually from the field and greenhouse for isolation of cucumber endophytic and rhizosphere soil fungi. All 74 genera and 1275 fungal strains were sequenced by rDNA ITS. The PDA media yielded the highest number of genera isolated from cucumber plants, rhizosphere soil and both compared to other media. There were no significant differences among the 4 media for the isolation of cucumber endophytic fungi. The best media for isolating fungi from roots and stems were MRBA and PDA, respectively. PDA and CZA had higher isolation efficiency for the rhizosphere soil fungi than MRBA. The 28 fungal genera had high isolation efficiency, and the endophytic Trichoderma strains were best isolated by MEA. It is suggested that PDA can be used as a basic medium, and different media can be considered for specific fungal genera.

Arylsulfatase and β-glucuronidase are two important enzymes in human, which play important role on dynamic equilibrium of steroidal estrogens. This work probably for the first time reported that hydrogen peroxide (H2O2), hypochlorite and peracetic acid (PAA) could effectively inhibit the activities of arylsulfatase and/or β-glucuronidase. The 50 percent of inhibitions (IC50) of H2O2, and PAA on arylsulfatase were found to be 142.90±9.00, 91.83±10.01, and 43.46±2.92 μM, respectively. The corresponding respective IC50 of hypochlorite and PAA on β-glucuronidase were 704.90±41.40 and 23.26±0.82 μM, while H2O2 showed no inhibition on β-glucuronidase. It was further revealed that the inhibition of hypochlorite on both arylsulfatase and β-glucuronidase was irreversible. On the contrary, the inhibition by H2O2 and PAA was reversible. Moreover, it was found that the inhibitions of arylsulfatase and/or β-glucuronidase by these three chemicals were pH-dependent, among which the inhibition by H2O2 was competitive and non-competitive for PAA. In general, H2O2 and hypochlorite can be endogenously produced in human, which suggested that the two compounds are potential endocrine disruption compounds (EDCs) as they can cause endocrine disruption via inhibition of arylsulfatase and β-glucuronidase. This work further indicated that any agent that can induce production of H2O2 or hypochlorite in human is potential EDC, which explains why some EDCs with very weak or no estrogenic potency can cause endocrine disruption that confirmed in epidemiological studies.

In this study, the hot deformation of Cu-0.55Sn-0.08La (wt%) alloy was studied by gleeble-3180 testing machine at deformation temperatures of 400-700oC and various strain rates. The stress-strain curve showed that the hot deformation behavior of Cu-0.55Sn-0.08La (wt%) alloy was greatly affected by work hardening, dynamic recovery, and dynamic recrystallization. The activation energy Q was calculated as 287.141 kJ/mol , and hot compression constitutive equation was determined as ε ̇=[sinh(0.006388σ)]^12.123∙exp⁡(37.7505-287.141/RT). The microstructural evolution of the alloy during deformation at 400oC revealed the presence of both slip and shear bands in the grains. At 700oC, dynamic recrystallization grains were observed but recrystallization was incomplete. In sum, these results provided the theoretical basis for continuous extrusion process of alloys with promising future use.

The uncertainty in the secondary path of an Active Noise Control (ANC) headphone affects the waterbed effect and stability of the feedback system. This study focuses on the uncertainty of the secondary path when real users wear headphones, and proposes a new uncertainty constraint based on the measured results of the secondary path transfer function under different wearing conditions of dummy head and limited subjects. This constraint and a cascaded second-order infinite impulse response filter with fixed coefficients are used to formulate a control strategic function, which is optimized by the Improved Grey Wolf Optimizer (IGWO) algorithm to obtain the optimal controller with better noise reduction performance. The proposed method and simulation model are validated based on the experimental test results. The results demonstrate that the safety factor and waterbed suppressing factor contained in the proposed uncertainty constraint ensures more stable noise reduction and effective suppression of the waterbed effect for new subjects without a priori data.

Purpose: This study builds upon an established effective training method to investigate the advantages of high variability phonetic identification training for enhancing lexical tone perception and production in Mandarin-speaking pediatric cochlear implant (CI) recipients, who typically face ongoing challenges in these areas. Method: Thirty two Mandarin-speaking children with CIs were quasi-randomly assigned into the training group (TG) and the control group (CG). The sixteen TG participants received five sessions of high variability phonetic training (HVPT) within a period of three weeks. The CG participants did not receive the training. Perception and production of Mandarin tones were administered before (pretest) and immediately after (posttest) the completion of HVPT via lexical tone recognition task and picture naming task. Both groups participated in the identical pretest and posttest with the same time frame between the two test sessions. Results: TG showed significant improvement from pretest to posttest in identifying Mandarin tones for both trained and untrained speech stimuli. Moreover, perceptual learning of HVPT facilitated trainees’ lexical tone production as rated by a cohort of 10 Mandarin-speaking adults with normal hearing. In contrast, CG did not exhibit significant changes in either perception or production. Conclusion: The results represent initial evidence of HVPT-induced transfer of perceptual learning to lexical tone production in CI users, which supports the application of this speech training protocol to aural rehabilitation practice.

Background: Wheat root rot disease due to soil-borne fungal pathogens leads to tremendous yield losses worth billions of dollars worldwide every year. It is very important to study the relationship between rhizosphere fungal diversity and wheat roots to understand the occurrence and development of wheat root rot disease. Results: A significant difference in fungal diversity was observed between the diseased and healthy groups in the heading stage, but the trend was the opposite in the filling stage. The abundance of most genera with high richness decreased significantly from the heading to the filling stage in the diseased groups; the richness of approximately one-third of all genera remained unchanged, and only a few low-richness genera, such as Fusarium and Ceratobasidium, had a very significant increase from the heading to the filling stage. In the healthy groups, the abundance of most genera increased significantly from the heading to the filling stage; the abundance of some genera did not change markedly, or the abundance of very few genera increased significantly. Physical and chemical soil indicators showed that low soil pH and density, increases in ammonium nitrogen, nitrate nitrogen and total nitrogen contributed to the occurrence of wheat root rot disease. Conclusions: Our results revealed that in the early stages of disease, highly diverse rhizosphere fungi and a complex community structure can easily cause wheat root rot disease. The existence of pathogenic fungi is a necessary condition for wheat root rot disease, but the richness of pathogenic fungi is not necessarily important. The increases in ammonium nitrogen, nitrate nitrogen and total nitrogen contributed to the occurrence of wheat root rot disease. Low soil pH and soil density are beneficial to the occurrence of wheat root rot disease.

In order to understand the response mechanism between plant stress, physiological indicators and hyperspectral indices, pot experiments were conducted on Suaeda salsa seedlings collected from a coastal wetland area to reveal the effects of salt stress on the physiological indicators and reflectance spectra of Suaeda salsa at the canopy and leaf level. The Suaeda salsa seedlings were exposed to seven salt treatments of different concentrations (0 mmol/L (control), 50 mmol/L, 100 mmol/L, 200 mmol/L, 300 mmol/L, 400 mmol/L, and 600 mmol/L) in natural conditions. The physiological indicators of plant height, fresh weight, dry weight, leaf succulence, chlorophyll content, and carotenoid content were measured, in addition to the reflectance spectra of Suaeda salsa at both the canopy and leaf level. Firstly, the effects of salt stress on the physiological indicators and reflectance spectra were analyzed by the qualitative and quantitative methods. Then, physiological indicators sensitive to salt stress were further retrieved. Afterwards hyperspectral indices such as a/b and ((a-b)/(a+b) ) sensitive to salt stress were also extracted by one-way analysis of variance (ANOVA) and Student-Newman-Keuls (S-N-K) comparison test. Our results showed that plant height, root length, leaf succulence, biomass, Chl-a, and Chl-b were sensitive to salt stress, while carotenoids (Car) and relative water content on the root were not significantly affected by salt stress. At the salt concentration of 200 mmol/L, plant height, biomass, relative water content, leaf succulence peaked. With enhanced salt stress, physiological indicators decreased. The first-order derivative spectral reflectance has the highest correlation with salt stress, compared to the control. The spectral index most sensitive to the salt stress at the canopy level is (D₉₀₃−D₈₅₁)/(D₉₀₃+D₈₅₁), for which the multiple determination coefficient (r²) is 0.9216. While the most sensitive spectral index to the salt stress is (D₄₄₂−D₆₆₇)/(D₄₄₂+D₆₆₇) at the leaf level, for which the r² is −0.898. In summary, the results indicated that there exists the quantitative relationship between the physiological indicators and spectra reflectance under salt stress and hyperspectral plant indices can effectively estimate the degree of salt stress. The inconsistency between the diagnostic hyperspectral plant indices at the canopy and leaf levels may be caused by the observation conditions, canopy structure.

A new optical steganography scheme is proposed that transmits a stealth optical code-division multiple-access (OCDMA) signal through a public binary phase-shift keying (BPSK) channel. Polarization beam splitters and arrayed waveguide gratings are used to implement a spectral-polarization coding (SPC) system with an incoherent optical source. We employ a Walsh–Hadamard code as the signature code of the user who wants to transmit stealth information using the system. A free space optical link applied to this system maintains the polarization states of light during propagation. The secret data is extracted using correlation detection and balanced subtraction in the OCDMA decoder of the intended receiver, and the other signal from the public channel is reduced by the OCDMA decoder. At the demodulator of the public channel, BPSK demodulation eliminates the stealth signal so that the public channel is not affected by the stealth signal. The two signals cannot interfere with each other. The results of this study show that our proposed optical steganography system is highly secure. The stealth signal can be favorably hidden in the public channel when the average source power of the stealth signal, public noise, and public signal are −5, −3, and 0 dBm, respectively.

Contaminants of Emerging Concern (CECs), a new category of contaminants in limelight, is a major issue of global concern. The pervasive nature of CECs and its harmful effects, such as cancer, reproductive disorders, neurotoxicity etc., make the situation alarming. The perilous nature of CECs lies in the fact that even very small concentration of CECs can cause great impacts on living beings. It also has a nature of bioaccumulation. Thus, it is the ultimate need to have efficient sensors for detection of CECs to ensure safe living environment. Electrochemical sensors are an efficient platform for CEC detection as they are highly selective, sensitive, stable, reproducible, and prompt, and can detect very low concentrations of analyte. Major classes of CECs are pharmaceuticals, illicit drugs, personal care products, endocrine disruptors, newly registered pesticides, and disinfection by-products. This review focusses on CECs, including their sources and pathways, health effects caused by them, and electrochemical sensors as reported in literatures under each category for the detection of major CECs.

Strigolactones (SLs) are a novel emerging plant hormones, which play important roles in regulating plant organ development and environmental stress tolerance. Even though the SL related genes have been identified and well characterized in some plants. The information of SL related genes in soybean is not fully established yet, especially in response to salt stress. In this study, we identified nine SL biosynthesis genes: two D27, two CCD7, two CCD8, and three MAX1, and seven SL signaling genes: two D14, two MAX2 and three D53 in soybean genome. We found that SL biosynthesis and signaling genes are conserved during evolution in different species. Syntenic analysis of these genes revealed their location on nine chromosomes as well as existence of ten pairs of duplication genes. Moreover, plant hormone and stress-responsive elements were identified in the promoter regions of SL biosynthesis and signaling genes. By using quantitative real-time PCR (qRT-PCR), we confirmed that SL genes have different tissue expression in roots, stems and leaves. Further, we also explored the expression profiles of SL biosynthesis and signaling genes under salt stress. These results suggested that SL signaling genes may play important regulatory roles in response to salt stress. In conclusion, we identified and provided valuable information on the soybean SL biosynthesis and signaling genes, and established a foundation for further functional analysis of soybean SL related genes in response to salt stress.

We investigate and discuss in detail the structure of the restricted singular value decomposition for a tensor triplet under t-product (T-RSVD). The algorithm is provided with a numerical example illustrating the main result. For applications, we consider color image watermarking processing with T-RSVD.

Optical fiber sensors based on tapered optical fiber (TOF) structure have attracted a considerable amount of attention from researchers due to the advantages of simple fabrication, high stability, diverse structures, and have great potential for applications in many fields such as physics, chemistry and biology. Compared with ordinary optical fibers, TOF with their unique structural characteristics significantly improve the sensitivity and response speed of fiber-optic sensors and broaden the application range. This review presents an overview of the latest research status and characteristics of fiber-optic sensors and TOF sensors. Then the working principle of TOF sensors, fabrication schemes of TOF structures, novel TOF structures in recent years, and the growing emerging application areas are described. Finally, the development trends and challenges of TOF sensors are prospected. The objective of this review is to convey novel perspectives and strategies for the performance optimization and design of TOF sensors based on fiber-optic sensing technologies.

In the present work, the effects of ageing treatment on the microstructures of a near-β Ti alloy (TC18) are studied. The influence of ageing treatment on the tensile properties and failure mechanisms are systematically analyzed. It is found that the size and morphology of the primary α (αp) phases are insensitive to ageing temperature and time. Furthermore, the ageing temperature and time dramatically influence the precipitation of the secondary α (αs) phases. Massive αs phases precipitate and gradually coarsen, and finally weave together with increasing the ageing temperature or extending the ageing time. The thickness of αs phases is responsible for the material strengths, while the content of α phases can enhance the material ductility. The ductile characteristics of the alloy with coarser αs phases are more obvious than those with thinner αs phases. Therefore, the ageing treatment is helpful for the precipitation and homogeneous distribution of αs phases, which is essential for balancing the strengths and ductility of the studied Ti alloy.

Under the double pressure of climate change and human activities, the restrictions of conservation policies and the increasing area of overlap between wildlife conservation areas and community living areas have led to increase conflicts and contradictions between nature reserves and neighboring communities. Effective management of such conflicts is particularly important in order to achieve reconciliation of conservation and development. In this study, we take the Mikumi-Selous region in Tanzania, Africa as an example, and through questionnaire surveys and semi-structured interviews, we sort out the current situation of conflicts between nature reserves and communities in the region, as well as summarize the means of conflict governance. In addition, we focus on identifying the various factors affecting community residents' protection willingness and protection action, and further verify the relationships among residents' family characteristics, protection costs and revenue, protection cognition, willingness and action through empirical analysis methods. The results show that residents' protection cognition has a significant positive effect on their willingness to protect and their actions, meanwhile willingness to protect also positively affects residents' protection action. In addition, it was found that the protection cost inhibits residents' willingness and action. Our study focuses on the willingness to participate and action of core stakeholders towards conflict governance from the perspective of community governance, emphasizing the key role of community participation in achieving coordinated development of biodiversity conservation and community. It provides a new perspective for mitigating conservation and development issues.

Saikosaponin (SS) a is a compound with various pharmacological properties and easily degraded into SSb1 and SSg in acid condition. In present work another two new degradation products of SSa formed under acid hydrolytic condition were detected and isolated by analytical and semi-preparative liquid chromatography technology, furthermore their structures were characterized as hydroxyl-saikosaponin a and SSb2 by spectral analysis, which is not only essential in stability-indicating method development and validation but also could be used as a worst case to assess the analytical method performance of SSa. Moreover their structural transformation pathways were also proposed.

Purpose: Hearing assistive technology (HAT) has been shown to be a viable solution to the speech-in-noise perception (SPIN) issue in children with autism spectrum disorder (ASD); however, little is known about its efficacy in tonal language speakers. This study compared sentence-level SPIN performance between Chinese children with ASD and neurotypical (NT) children and evaluated HAT use in improving SPIN performance and easing SPIN difficulty. Methods: Children with ASD (n=26) and NT children (n=19) aged 6-12 performed two adaptive tests in steady-state noise and three fixed-level tests in quiet and steady-state noise with and without using HAT. Speech recognition thresholds (SRT) and accuracy rates were assessed using adaptive and fixed-level tests, respectively. Parents or teachers of the ASD group completed a questionnaire regarding children’s listening difficulty under six circumstances before and after a ten-day trial period of HAT use. Results: Although the two groups of children had comparable SRTs, the ASD group showed a significantly lower SPIN accuracy rate than the NT group. Also, a significant impact of noise was found in the ASD group’s accuracy rate, but not in the NT group’s. There was a general improvement in the ASD group’s SPIN performance with HAT and a decrease in their listening difficulty ratings across all conditions after the device trial. Conclusion: The findings indicated inadequate SPIN in the ASD group using a relatively sensitive measure to gauge SPIN performance among children. The markedly increased accuracy rate in noise during HAT-on sessions for the ASD group confirmed the feasibility of HAT for improving SPIN performance in controlled laboratory settings, and the reduced post-use ratings of listening difficulty further confirmed the benefits of HAT use in daily scenarios.

The transforming growth factor-β (TGF-β), in which overexpression have been associated with various diseases, has become an attractive molecular target for the treatment of cancers. Three series of 3-substituted-4-(quinoxalin-6-yl) pyrazoles 14a–h, 15a–h, 16a–h, 22a, 22b, 22d, 23a, 23b, 23d, 24b, and 24d were synthesized and evaluated for their activin receptor-like kinase 5 (ALK5) and p38α mitogen activated protein (MAP) kinase inhibitory activity in an enzymatic assays. Among these compounds, the most active compound 16f inhibited ALK5 phosphorylation with an IC₅₀ value of 0.28 µM, with 98% inhibition at 10 µM. Compound 16f also had good selectivity index of >35 against p38α MAP kinase, with 9.0-fold more selective than clinical candidate, compound 3 (LY-2157299). Molecular docking study was performed to identify the mechanism of action of the synthesized compounds and their good binding interactions were observed. ADMET prediction of good active compounds showed that these ones possess good pharmacokinetics and drug-likeness behavior.

Three new polyketides (penidihydrocitrinins A–C, 1–3) and 14 known compounds (4–17) were isolated from the deep-sea-derived Penicillium citrinum W17. Their structures were elucidated by comprehensive analyses of 1D and 2D NMR, HRESIMS, and ECD calculations. Compounds 1–17 were evaluated for their anti-inflammatory and anti-osteoporotic bioactivities. All isolates exhibited significant inhibitory effects on microglial activation in LPS-stimulated BV-2 cells in a dose-response manner. Notably, compound 14 displayed the strongest effect with the IC50 value of 4.7 µM. Moreover, compounds 6, 7, and 8 not only suppressed osteoclastogenesis, but also promoted osteoblast mineralization.

A fast calculation method for the full parallax high-resolution hologram is proposed based on the elemental light field image (EI) rendering. A 3D object located near the holographic plane is firstly rendered as multiple EIs with a pinhole array. Each EI is interpolated and multiplied by a divergent sphere wave and interfered with a reference wave to form a hogel. Parallel acceleration is used to calculate the high-resolution hologram because calculation of each hogel is independent. A high-resolution hologram with the resolution of 20,0000×20,0000 pixels is calculated only within 8 minutes. Full parallax high-resolution 3D displays are realized by optical reconstructions.

The SARS coronavirus 2 (SARS-CoV-2) is the causative agent of the 2019 coronavirus disease (COVID-19) pandemic that has executed 6.9 million people and infected over 765 million. It’s become a major worldwide health alarm and is also known to cause abnormalities in various systems, including the hematologic system. COVID-19 infection primarily affects the lower res-piratory tract and can lead to a cascade of events, including a cytokine storm, intravascular thrombosis, and subsequent complications such as arterial and venous thromboses. COVID-19 can cause thrombocytopenia, lymphopenia, and neutrophilia, which are associated with worse out-comes. Prophylactic anticoagulation is essential to prevent complication and death rate associated with the virus's effect on the coagulation system. It is crucial to recognize these complications early and promptly start therapeutic anticoagulation to improve patient outcomes. While rare, COVID-19-induced disseminated intravascular coagulation exhibits some similarities to DIC induced by sepsis. LDH, D-dimer, ferritin, and CRP biomarker are often increase in serious COVID-19 cases and poor prognosis. Understanding the pathophysiology of the disease and identifying risk factors for adverse outcomes is critical for effective management of COVID-19.

The corrected mechanism model of battery voltammetric function is helpful to guide the development and application of battery. There are two scientific issues that need to be answered: First, how many mechanisms do batteries have; Second, how to establish the mechanism model separately under the overlapping of these mechanisms. Volt-ampere characteristics of both linear state and nonlinear state exist; the monotonic decreasing of volt-ampere characteristics indicates that the battery have only three kinds of mechanisms. Without changing the basic form of the function and under the principle of the mechanism function’s working region considered, we propose a mechanism function which satisfies the monotonic decreasing characteristic of the voltammetric curve of battery, via the derivative law of each mechanism function in the voltammetric function of battery. By using the voltammetric data, the obtained cell mechanism function can accurately predict the potential (current or voltage) when the independent variable of the cell is zero, and provide the theoretical basis for the internal working mechanism of the cell, which can guide the practice.

In this study, we resequenced the mitogenomes of P. megacephalus from different regions using a “primer bridging” approach with Sanger sequencing technologies. The mitogenome of this species was found to contain two copies of the ND5 genes and three copies of the control regions. Furthermore, multiple tandem repeats were identified in the control regions. Notably, we observed that there was no correlation between the distribution of species and their genetic distance. However, our research revealed the discovery of the “missing” ATP8 gene in P. megacephalus as well as three other previously published Polypedates, as a result of manual data curation. Using the mitogenome, gene expression analysis was performed via RT-qPCR of liver samples and determined that COIII, ND2, ND4, and ND6 were reduced to 0.64±0.24, 0.55±0.34, 0.44±0.21 and 0.65±0.17 under the low-temperature stress (8℃), respectively, as compared with controls (P<0.05). Remarkably, the transcript of long non-coding RNA (LncRNA) between positions 8029 and 8612 decreased significantly with exposure to low-temperature stress (8℃). Antisense ND6 gene expression showed a downward trend but this was not significant. These results reveal that modulations of protein-coding mitogenomes genes and lncRNAs of P. megacephalus play a crucial part in the molecular response to cold stress.

Channel bends are one of the most important characteristic features of natural streams. These bends often create the conditions for a hyporheic zone, which has been recognized as a critical component of stream ecosystems. The streambed vertical hydraulic conductivity (K_v), vertical hydraulic gradient (VHG) and Darcian flux (DF) in the hyporheic zone were estimated at 61 locations along a channel bend of the Beiluo River during July 2015 and January 2016. All the streambed attributes showed great spatial variability along the channel bend. Both upward fluxes and downward fluxes occurred during the two test periods, most of studied stream sections were controlled by downwelling, indicating stream water discharge into the subsurface. The average downward flux was higher at the downstream side than at the upstream side of the channel bend, especially in July 2015. The distribution of streambed sediment grain size has a significant influence on the variability of K_v; high percentages of silt and clay sediments generally lead to low K_v values. Higher K_v at the depositional left bank at the upstream site shifted toward the erosional right bank at the downstream site, with K_v values positively correlated with the water depth. This study suggested that the variabilities of K_v and VHG were influenced by the stream geomorphology and that the distribution of K_v was inversely related, to a certain extent, to the distribution of VHG across the channel bend. K_v and VHG were found to have opposite effects on the DF, and the close relationship between K_v and DF indicated that the water fluxes were mainly controlled by K_v.

The presence of phase diffusion can lead to the loss of the advantages of quantum measurements. Squeezing is considered to be an effective method to reduce the detrimental effect of phase diffusion on the measurement. The Mach-Zehnder (MZ) interferometer has been exploited as a generic tool for precise phase measurement. Describing the reduction in quantum advantage caused by phase diffusion in an MZ interferometer that can be mitigated by squeezing is not easy to handle analytically, because the input state will change from a pure state to a mixed state after experiencing the diffusion noise in the MZ interferometer. We introduce a truncated MZ interferometer that can achieve the same potential phase sensitivity as the conventional MZ interferometer. This scheme can theoretically explain how phase diffusion reduces phase estimation and why squeezing counteracts in the presence of phase diffusion. Using the Gaussian property of the input state and the characteristic of Gaussian operation in the squeezing, the two orthogonal field quantities of the quantum state are squeezed and anti-squeezed to different degrees, and the analytic results are obtained. The truncated MZ interferometer is simpler to build and operate than the conventional MZ interferometer, and also mitigates the phase diffusion noise by the squeezing operation, thus making it useful for applications in precision metrology.

We performed a retrospective, observational study for 51 eyes of 51 treatment-naive patients with polypoidal choroidal vasculopathy (PCV), whose lesion ranged within the 6x6mm scope of optical coherence tomography angiography (OCTA). Patients were divided into two groups based on the pattern of branching vascular network (BVN) on OCTA: ill-defined group and well-defined group. BVN morphology was not related to baseline best-corrected visual acuity (BCVA). But the BCVA in the ill-defined BVN group (-0.18 [interquartile range: -0.40 to 0.00]) was significantly improved after anti-vascular endothelial growth factor (VEGF) injections, compared with that (0.00 [interquartile range: -0.18 to 0.00]) in the well-defined group (z=2.143, p=0.032). Multiple logistic regression analysis showed that male sex, smaller number of injections, and presence of polypoidal lesions on OCTA images at baseline predicted a poor prognosis of polypoidal lesions on OCTA images after anti-VEGF therapy (all p&lt;0.05). Finally, BCVA at baseline and the number of injections were protective factors for BCVA after anti-VEGF therapy (all p&lt;0.05). In contrast, history of hypertension and macular edema at baseline were risk factors for BCVA after anti-VEGF injections (all p&lt;0.05). Our results revealed the visual and morphological prognosis of patients with active subfoveal circumscribed PCV after anti-VEGF therapy.

Although deep learning has received extensive attention and achieved excellent performances in various of scenarios, it suffers from adversarial examples to some extent. Especially, physical attack poses more threats than digital attack. However, existing researches pay less attention to physical attack of object detection in remote sensing images (RSIs). In this work, we systematically analyze the universal adversarial patch attack for multi-scale objects in the remote sensing field. There are two challenges for adversarial attack in RSIs. On one hand, the number of objects in remote sensing images is more than that of natural images. Therefore, it is difficult for adversarial patch to show adversarial effect on all objects when attacking a detector of RSIs. On the other hand, the wide range of height of photography platform causes that the size of objects diverse a lot, which brings challenges for generating universal adversarial perturbation for multi-scale objects. To this end, we propose an adversarial attack method on object detection for remote sensing data. One of the key ideas of the proposed method is the novel optimization of adversarial patch. We aim to attack as many objects as possible by formulating a joint optimization problem. Besides, we raise a scale factor to generate a universal adversarial patch that adapts to multi-scale objects, which ensures the adversarial patch is valid for multi-scale objects in the real world. Extensive experiments demonstrate the superiority of our method against state-of-the-art methods on YOLO-v3 and YOLO-v5. In addition, we also validate the effectiveness of our method in real-world applications.

Chalcones are a class of flavonoids possessing a variety of biological activities, including antimicrobial and antioxidant effects. Therefore, chalcones and their derivatives have potential use in the control of postharvest diseases. In this work, the effects of 2ʹ,4ʹ-dichloro-chalcone on the in vitro growth and in vivo pathogenicity of F. tricinctum and T. roseum were investigated. The results showed that 100 µM of 2ʹ,4ʹ-dichloro-chalcone strongly inhibited mycelial growth and conidial production of F. tricinctum (32.3%) and T. roseum (65.2%) in vitro. This treatment also significantly inhibited the expansion of potato dry rot from F. tricinctum (48.6%) and apple rot spot from T. roseum (36.2%). The incubation of F. tricinctum and T. roseum conidia with this agent for 2 h increased their cell membrane permeability by 25% and 22.5%, respectively and conidial membrane permeability by 41.7 and 65.4%, respectively. This treatment also significantly inhibited the total respiration rate and activated the cyanide-resistant respiratory pathway in both pathogens. Protein immunoblotting showed that the treatment increased alternative oxidase (AOX) levels after 4 h in F. tricinctum and T. roseum by 52.76% and 39.13%, respectively. Conclusion: 100 µM 2ʹ,4ʹ-dichloro-chalcone significantly inhibited mycelial growth and spore production in F. tricinctum and T. roseum in vitro and reduced their pathogenicity in postharvest potato and apple crops. Further analysis indicated that 2ʹ,4ʹ-dichloro-chalcone disrupted the integrity of cell membranes and the mitochondrial respiratory electron transport chain which leaded to ROS burst and oxidative stress, AOXs were induced directly or indirectly, and the cyanide resistant respiratory pathway was activated. The in vitro growth and pathogenicity of F. tricinctum and T. roseum were inhibited.

The genus Flavivirus includes 53 members and poses a big threat to human health among worldwide. Diseases caused by flavivirus infections can be broadly classified into hemorrhagic diseases (Dengue, Yellow fever, etc) and neurological diseases (West Nile disease, Zika disease, etc). Many flaviviruses still lack specific treatments and effective vaccines. In this context, it becomes particularly important to thoroughly characterize the pathogenesis of flavivirus infection and develop animal models. Therefore, animal models that can accurately simulate human diseases are essential for evaluating the effectiveness of therapeutic drugs and preventive vaccines. In this paper, we provide a comprehensive review of the currently available animal models that support flavivirus infection and exhibit clinical manifestations related to flavivirus infection. Additionally, we discuss the strengths and limitations of each animal model, aiming to enhance researchers understanding of the use of animal models in flavivirus research. This insight is intended to facilitate further studies into the pathogenesis of flavivirus, as well as the development of antiviral agents and vaccines.

Looking at different operating climatic conditions, the electrical behavior predicting photovoltaic modules gets very important. For the estimation of output power from photovoltaic (PV) plants this is a very essential and basic aspect. In this paper, the relationship between the I-V curve and the irradiation spectrum is discussed by combining the single diode model. An explicit elementary analytical model with two defined shape parameters is discussed and improved with three approximations and second order Taylor expansion. Then, the explicit elementary analytical model is investigated under varying conditions leveraging the four parameters I_ph, I₀, R_s and R_sh from the single diode model. The relationship between the physical parameters and the condition parameters are discussed and applied to extract the shape parameters at different scenarios. Considering the aging effect, the process of calculation to predict the I-V curve under different splitting spectra is simplified as follow: (1) two shape parameters are gotten from the I-V data at measurement reference conditions (MRC); (2) the short circuit current, open circuit voltage and shape parameters under any splitting spectrum can be calculated based on the relationship provided in article; (3) the performance of PV panel can be predicted with parameters. The validation of this model was experimentally proven leveraging monocrystalline silicon photovoltaic module with different splitting films. Results showed that the model accurately predicts the I-V characteristics for the examined PV modules at different irradiance spectra and cell temperatures. Moreover, the presented model performs superior compared to other investigated models when looking at accuracy and simplicity.

In order to realize the sustainable utilization of water resources and the sustainable development of economy, the evaluation index system of water use efficiency system and economic development system was constructed. Entropy weight method and comprehensive evaluation method were adopted to determine the index weights and conduct comprehensive evaluation for the two systems. The coupling coordination model was used to calculate the coupling degree, coordination degree and coupling coordination degree of the two systems. The annual coupling stage and coupling coordination intensity of the two systems were analyzed and determined. The results showed that the comprehensive evaluation values of both water use efficiency system and economic development system in Jinan City increased greatly from 2008 to 2017, and showed a changing trend of ups and downs. The two systems were in the antagonistic stage, and were gradually approaching the running-in stage, indicating that they were in the state of common development. The coupling coordination degree of the two systems gradually increased in waves, progressed from the moderately to the highly coordinated coupling. In the future, if the water control path appropriate to Jinan City can be explored actively, the water-saving kinetic energy of economic development can be increased constantly, and the linkage effect between economic development and water resources utilization can be given full play to, the two systems will be in the orbit with the benign interaction and healthy harmonious development.

Lung cancer is almost the most common cause of cancer death in the world. Clinically, the conventional therapy to eradicate the cancer cells is chemotherapy but a better drug remains required. In this study, the effects of three bufadienolides, kalantuboside B, kalantuboside A and bryotoxin C, isolated from Kalanchoe tubiflora (Harvey) were evaluated and characterized in CL1-5 highly metastatic human lung cancer cells. Contrary to the apoptosis-promoting activity in other cancer cells, these three bufadienolides did not induce apoptosis in CL1-5 cancer cells. Instead, they activated an autophagy pathway, as indicated by the increase of autophagosomes formation. The induction of autophagy by these three bufadienolides was demonstrated to link to down-regulation of p-mTOR as well as up-regulation of LC3-II, ATG5, ATG7, Beclin-1. Moreover, among these three compounds, kalantuboside B in which a monosaccharide is attached at the bufadienolide aglycon, exhibited a better autophagy induction. Our findings revealed an alternative mechanism of drug action by bufadienolides in lung cancer cells and provided evidence for the possibility of treating highly metastatic human lung cancer through an autophagy pathway.

Tilapia lake virus (TiLV) is the main tilapia-infecting virus worldwide, causing serious economic losses. However, there is no vaccine for this viral disease. Here, TiLV ORF10 (TiLV-ORF10) encoding a protein with abundant epitopes was constructed into the eukaryotic expression vector pcDNA3.1, and used to evaluate the immune protective effects in Nile tilapia (Oreochromis niloticus). RT-PCR and western blot analyses confirmed vaccine plasmid expression in tilapia muscle tissues. Moreover, the transcription levels of immunoglobulin M, toll-like receptor 2, myeloid differentiation factor 88, interleukin 8, tumor necrosis factor alpha, gamma-IFN, and nuclear factor κB immune-related genes were statistically significantly upregulated in the spleen, liver, and kidney of vaccinated tilapias (P < 0.05). TiLV challenge experiments showed that relative percent survival (RPS) was significantly enhanced in fish by this DNA vaccine. Moreover, RPS was enhanced further when using a higher amount of the DNA vaccine (85.72% RPS at a DNA dose of 45 μg pcDNA3.1–ORF10). Vaccination with pcDNA3.1–ORF10 significantly reduced virus replication, as evidenced by the low amount of virus in the spleen, liver, and kidney of vaccinated tilapias after TiLV challenge. Thus, pcDNA3.1–ORF10 could induce protective immunity in tilapia and may be a potential vaccine candidate for controlling diseases caused by TiLV.

Wetlands, which is composed of soil, vegetation and water, has sufficient water supply and is sensitive to climate change. This study analyzed the coupling degree between wetlands and atmosphere, and discussed the influence of environmental factors (solar radiation and water vapor pressure deficit) on latent heat flux by using the experimental data from the Maduo Observatory of Climate and Environment of the Northwest Institute of Eco-Environment and Resource, CAS and WRF model. The results showed, during the vegetation growthing season, the average value of Ω (decoupling factor) is 0.38 in alpine wetlands, indicating the coupling between wetlands and atmosphere is poor; Solar radiation is the main factor influencing the latent heat flux in the results of both observation data analysis and model simulation, and solar radiation and water vapor pressure deficit still have an opposite reaction to latent heat flux; when solar radiation and water vapor pressure deficit increase by 30%, the average daily amount of latent heat flux increases from 5.57 MJ·m-2 to 7.50 MJ·m-2 and decreases to 5.17 MJ·m-2, respectively. This study provides a new research approach for the study of the parameterization of latent heat flux and evapotranspiration under the context of global climate change.

In recent years, governments applied intelligent transportation system (ITS) technique to provide several convenience services (e.g., garbage truck app) for residents. This study proposes a garbage truck fleet management system (GTFMS) and data feature selection and data clustering methods for travel time prediction. A GTFMS includes mobile devices (MD), on-board units, fleet management server, and data analysis server (DAS). When user uses MD to request the arrival time of garbage truck, DAS can perform the procedure of data feature selection and data clustering methods to analyses travel time of garbage truck. The proposed methods can cluster the records of travel time and reduce variation for the improvement of travel time prediction. After predicting travel time and arrival time, the predicted information can be sent to user’s MD. In experimental environment, the results showed that the accuracies of previous method and proposed method are 16.73% and 85.97%, respectively. Therefore, the proposed data feature selection and data clustering methods can be used to predict stop-to-stop travel time of garbage truck.

Semi-continuous data are very common in the social science and economics. In this paper, a Bayesian variable selection procedure is developed to assess the influence of exogenous factors including observed and unobserved on the semi-continuous data. Our formulation is based on the two-part latent variable model with polytomous response. We consider two schemes for the penalties of regression coefficients and factor loadings: the Bayesian spike and slab bimodal prior and the Bayesian lasso prior. Within the Bayesian framework, we implement Markov Chains Monte Carlo sampling method to conduct posterior inference. To facilitate posterior sampling, we recast the logistic model in part one as the norm-like mixture model. Gibbs sampler is designed to draw observations from the posterior. Our empirical results show that with suitable hyper-parameters, the spike and slab bimodal method slightly outperforms the Bayesian lasso in the current analysis. Finally, a real example related to the China household finance survey is analyzed to illustrate the application of the methodology.. .

Rhododendron is well-known for the colorful corolla. Molecular marker systems have the potentials to elucidate genetic diversity as well as to assess the genetic fidelity in rhododendrons. In the present study, the reverse transcription domains of long terminal repeat retrotransposons were cloned from rhododendrons and used to develop inter-retrotransposon amplified polymorphism (IRAP) marker system. Subsequently, 198 polymorphic loci were generated from the IRAP and inter-simple sequence repeat (ISSR) markers, of which 119 were derived from the IRAP markers. It was justified that in rhododendrons, IRAP markers were superior to the ISSRs in some polymorphic parameters such as the average number of polymorphic loci (14.88 versus 13.17). In comparison with the single one, the combination of IRAPs and ISSRs systems was more discriminative for detecting 46 rhododendron accessions. Further, IRAP markers demonstrated more efficiency in genetic fidelity detection of in vitro R. bailiens, an endangered species just recorded in Guizhzhou Province, China. The available evidences revealed the distinct properties of IRAP and ISSR markers in the rhododendron-associated applications, and highlighted the availability of highly informative ISSR and IRAP markers in the genetic diversity evaluation and the genetic fidelity assessment of rhododendrons, which may facilitate the preservation and genetic breeding in rhododendron plants.

We explored the trends and the diversity of the mortality and risk factors of age-standardized cardiovascular diseases (CVD) and cerebrovascular disease (CBD) from 2000 to 2020 in five advanced Asian countries, including China, Japan, Singapore, South Korea, and Taiwan. Data were obtained from the Global Burden of Disease (GBD) report. Overall, the CVD mortality rates decreased gradually in all five Asian countries. Singapore had the highest rates before 2011, but Taiwan replaced Singapore as the nation of the highest mortality rates after 2012. Additionally, South Korea had the highest CBD mortality rates before 2016, while Taiwan experienced a peak in 2011 and remained high thereafter. The absolute difference (AD) and relative difference (RD) for CVD mortality rates showed clear declining trends in all five countries, with South Korea and China displaying the highest reductions, respectively. It is noteworthy that overweight and obesity exhibited an increasing trend in all these five Asian countries, with China demonstrating the highest AD and RD. Except for Taiwan, where a negative association of r=-0.732 was observed, CVD mortality was positively associated with CBD, hypertension, and DM mortality in all other four countries, therefore, further investigation into these relationships are needed.

Is human capital heterogeneity a decisive factor for Chinese enterprises to invest in Africa? Based on the Outward Foreign Direct Investment (OFDI） data of Chinese enterprises in 37 African countries from 2007 to 2017, this paper using the FGLS model, is the empirical analysis of the mechanism and effect of the human capital heterogeneity of host countries on OFDI location selection. The human capital heterogeneity can be divided into four dimensions: scale, quality, cost and structure, which can be measured by health level, education level, wage level, child dependency ratio and old-age dependency ratio. The results show that: (1) the host country's human capital scale and child dependency ratio structure have a significant positive impact on decision-making for OFDI; (2) the cost of human capital and the structure of old-age dependency ratio are negatively correlated with the inflow of OFDI; (3) different from the existing conclusions, the quality of human capital will inhibit the inflow of OFDI in the sample period; (4) the extended test shows that the quality of human capital has a significant positive impact on OFDI decision-making. The results of robustness test are reliable. Finally, according to the conclusion of this paper, policy recommendations are put forward.

In response to the problem of no supporting equipment for the cultivation of Codonopsis in the hilly and mountainous areas of northwest China, a combined machine for transplanting outcrop of Codonopsis with micro ridge covered with film is designed. The key components of the prototype are analyzed and designed, and the structures and working parameters of the seedbed preparation device, seedling casting device, rotary tillage soil-covering device, film covering device, seedling head burial and film edge soil-covering device are determined. The transmission system scheme is established, and the working mechanism of the core components is analyzed. Field experiments show that when the target seedling spacing is 4.4cm and the machines moves forward at the speed of 0.1, 0.15, and 0.2m/s, the variation coefficient of planting spacing and the qualification rate of planting depth all meet the standard requirements. The qualified rate of planting posture and film side outcrop are greatly affected by the operating speed of the machine, and decrease with the increase of operating speed. When the operating speed reaches 0.1m/s, the average variation coefficient of planting spacing is 0.08%, the average qualified rate of planting depth, planting posture and film side outcrop is 95.83%, 94.17% and 93.33% respectively, which shows that the operating performance is better than that of the operating speed of 0.15m/s and 0.2m/s. This study provides new reference for the theoretical research and design of mechanized and automated transplanting machinery for Codonopsis seedlings.

This study used a two-stage network data envelopment analysis model to measure the water use efficiency of 108 cities in the Yangtze River Economic Belt in the initial water use and wastewater treatment phases from 2009 to 2019. We used the Dagum Gini coefficient to decompose the urban water use efficiency of six major urban clusters in the Yangtze River Economic Belt. We also used σ convergence and β convergence types to test the convergence characteristics of urban water use efficiency of six major urban clusters in the Yangtze River Economic Belt. This study found that the overall low level of water use efficiency in cities in the Yangtze River Economic Zone mainly stems from the low level of water use efficiency in the wastewater treatment stage. The 108 cities in the Yangtze River Economic Zone are divided into four types based on the average values of water use efficiency in the initial use and wastewater treatment phases; the highest number of cities are in the double-low category, with low average values of water use efficiency in the initial use and wastewater treatment phases. During the study period, spatial differences in urban water use efficiency in the Yangtze River Economic Zone narrowed, with the differences stemming mainly from hyperdensity, followed by intra- and inter-regional differences. Meanwhile, there is convergence in urban water use efficiency in the Yangtze River Economic Belt; significant β convergence in the urban agglomerations of the Yangtze River Delta, Jianghuai, middle reaches of the Yangtze River, Chengdu–Chongqing, and Central Yunnan; and insignificant β convergence in the Central Qian urban agglomeration. After considering control factors, such as industrial structure, financial development level, environmental regulation, economic development level, and science and education development level, the water use efficiency of the six major urban clusters in the Yangtze River Economic Belt converges faster, but the influence of these control factors on the water use efficiency of each urban cluster is heterogeneous. Research results have reference value for the development of improvement strategies on differentiated urban water use efficiency in the Yangtze River Economic Belt.

Background: Colorectal cancer (CRC) is one of the most prevalent diseases and the second leading cause of death worldwide. However, the relationship between CRC and cerebrovascular-specific mortality (CVSM) remains elusive and less is known about the influencing factors associated with CVSM in CRC. Here, we aimed to analyze the incidence as well as the risk factors of CVSM in CRC. Methods: Patients with a primary CRC diagnosed between 1973 and 2015 were identified from Surveillance Epidemiology and End Results database with follow-up data available until 31 December 2016. Conditional standardized mortality ratios were calculated to compare the incidence of CVSM between CRC patients and the general US population. Univariate and multivariate survival analyses with a competing risk model were used to interrogate the risk factors for CVSM. Results: A total of 563298 CRC individuals were included. The CVSM in CRC patients was significantly higher than the general population in all age subgroups. Among competing causes of death in patients, the cumulative mortality caused by cerebrovascular-specific diseases steadily increased during study period. While age and surgery positively influenced CVSM on both univariate and multivariate analyses, male patients and those who had radiotherapy, chemotherapy, more recent year (2001-2015) of diagnosis as well as multiple primary or distant tumors experienced a lower risk of CVSM. Interpretation: Our data suggest a potential role for CRC in the incidence of CVSM and also identify several significant predictors of CVSM, which may be helpful for risk stratification and therapeutic optimization of cerebrovascular-specific diseases in CRC patients.

Conservation tillage and deep side-fertilization both hold the potential to reduce nitrogen leaching and improve grain yield and nitrogen use efficiency in fragrant rice cultivation practices. However, the combined impact of different tillage practices with deep side-fertilization on nitrogen leaching remains uncertain. Therefore, this study conducted on-site experiments for four rice growing seasons in both early and late seasons in 2018 and 2019, using the fragrant rice varieties "Meixiangzhan 2"(MX) and "Xiangyaxiangzhan"(XY). The four experimental treatments included:conventional tillage with regular fertilization (T1), conventional tillage with simultaneous deep fertilization (T2), reduced tillage with simultaneous deep fertilization (T3) , and no-tillage with simultaneous deep fertilization (T4). Our results indicate that the T4 treatment exhibited higher nitrogen leaching rates and potential nitrogen losses throughout the entire rice growth cycle, with a 4.51% increase in total nitrogen leaching and a 1.86% increase in potential nitrogen leaching compared to T1. In contrast, the T2 treatment demonstrated the lowest nitrogen leaching rate, resulting in a 6.01% reduction in total nitrogen leaching and a 9.57% decrease in potential nitrogen leaching compared to T1, demonstrating the most optimal performance. For MX, the T1 treatment resulted in lower daily grain outputs compared to the other treatments, with disparities ranging from 5.35% to 9.94%. Similarly, for the XY, the T1 treatment yielded significantly lower daily grain outputs compared to the other treatments, with discrepancies ranging from 6.26% to 10.81% during the late season of 2019. Overall, this study shows that conventional tillage with deep fertilization effectively reduces nitrogen leaching and boosts fragrant rice yields. Minimizing nitrogen leaching enhances nitrogen utilization efficiency. These insights highlight the significance of strategic fertilization and cultivation for environmental conservation and agricultural sustainability.

Polysaccharide from Ficus carica L. (FCP) exert multiple biological activities, as a biological macromolecule, the available knowledge about the specific structures and mechanisms of biological activity of purified 'Brunswick' fig polysaccharide is currently limited. In the present study, by chemical purification and characteristics identified via specific instruments, and then the impact of FCP on the immunomodulation activity in vitro and in vivo was examined. Structural char-acteristics showed that the molecular weight of the FCP was determined to be 127.5 kDa, the primary monosaccharides present in the FCP were galacturonic acid (GalA), arabinose (Ara), galactose (Gal), rhamnose (Rha), glucose (Glc), and xylose (Xyl) at a ratio of 0.321:0.287:0.269:0.091:0.013:0.011. Based on the investigation of in vitro immunomodulatory ac-tivity, FCP was found to stimulate the production of NO, TNF-α, and IL-6 and increased the pi-nocytic activity of macrophages. Further analysis revealed that FCP activated macrophages by interacting with toll-like receptor 4 (TLR4). Moreover, the in vivo test results indicate that FCP showed significant increase serum pro-inflammatory factors in immunosuppressed mice. Overall, this study suggests that FCP has the potential to be utilized as a novel immunomodulator in the pharmaceutical and functional food industries.

The cutter structure and layout scheme of PDC (Polycrystalline Diamond Compact) bits are important factors in improving efficiency. To further improve the drilling efficiency of PDC bits, axe, triangular prism, and cylindrical PDC cutters were used as research objects. Based on the measured granite data, a finite element model of non-homogeneous granite was established and verified by uniaxial compression simulation. The rock-breaking process of different cutter combination schemes was compared using the finite element method, and the parameters in the best scheme were optimized using the Box-Behnken response surface method. The results show that the constructed model of non-homogeneous granite is consistent with the stress-strain relationship of real granite and is reliable. The axe PDC cutter is more aggressive than the other two cutters and is more suitable for the front row of the bit blade tooth arrangement, while the triangular prism cutter is the second most aggressive and is suitable for the rear row of tooth arrangement, and the best combination scheme is the front row of axe cutter and the rear row of triangular prism cutter arranged alternately with the axe cutter. The optimal transverse and longitudinal distances of the optimized triangular prism cutter from the front axe cutter are 10mm and 7mm, and the optimal transverse and longitudinal distances of the rear axe cutter from the front cutter are 10.06mm and 7mm. The drilling speed is more stable during drilling and the PDC bit with mixed tooth arrangement has 16.8% and 16.6% higher rate of penetration(ROP) compared with the bit with single axe cutter and triangular prism cutter, and the drilling speed is more stable during working, which can effectively improve the rock breaking efficiency of the PDC bit. The field application proves that the bit with mixed cutter arrangement is easier to break the complex formations, with more stable ROP and better efficiency. The study can provide theoretical support for the cutter layout of the PDC bit.

In this study, we design a new refractive index sensor based on a metal–insulator–metal waveguide coupled with a notched ring and vertical rectangular resonators. We use the finite element method to study the propagation characteristics of the sensor. According to the calculation results, the transmission spectrum exhibits a typical Fano resonance shape. The phenomenon of Fano resonance is caused by the coupling between the wide spectrum and narrow spectrum. In the design, the wide spectrum signal is generated by the vertical rectangular resonator, while the narrow spectrum signal is generated by the notched ring resonator. In addition, we varied the structural parameters of the resonators and filled the structure with media of different refractive indices to study the sensing properties. The maximum achieved sensitivity of the sensor reached 1071.4 nm/RIU. The results reveal potential applications of the coupled system in the field of sensors.

Pancreatitis and alcoholic pancreatitis are serious health concerns, and there is an urgent need for effective treatment strategies. Alcohol is a known etiological factor for pancreatitis, including acute pancreatitis (AP) and chronic pancreatitis (CP). Excessive alcohol consumption induces many pathological stress responses; of particular note is endoplasmic reticulum (ER) stress and adaptive unfolded protein response (UPR). ER stress results from the accumulation of unfolded/misfolded protein in the ER and is implicated in the pathogenesis of alcoholic pancreatitis. Here we summarize the possible mechanisms by which ER stress contributes to alcoholic pancreatitis. We also discuss potential approaches targeting ER stress and UPR for developing novel therapeutic strategies for the disease.

The need for cross-modal retrieval (CMR) among users is growing because of the swift advancements in computer vision and natural language processing. Promoting home operating systems is greatly aided by the openKylin home operating system. It is focused on enhancing the functionality of the operating system with safe and dependable operating technologies. Practical implications abound for integrating computer vision research into home operating systems. A multimodal retrieval approach based on openKylin is presented to improve the usability of text search graphs, audio, and video. The overview of pertinent domestic and international research is the main topic of this article. This technological advancement. It then offers details on the design, implementation procedure, and final implementation outcomes for demonstration. The works of natural operations show that this strategy has excellent accuracy and performance.

Bio-based packaging materials and efficient drug delivery systems are gaining attention, carboxymethyl cellulose (CMC) is one of the most soluble cellulose derivatives, is a good candidate material due to its biocompatibility, biodegradability, and reproducibility. However, CMC-based films are lack of sufficient mechanical properties, limiting its widespread application. In this paper, the molecular interactions between CMC and additives with different molecular structures have been studied with rheological method. The additives are chitosan and cellulose derivatives including O-carboxymethylated chitosan (O-CMCh), N-2-hydroxypropyl-3-trimethylammonium-O-carboxymethyl chitosan (HTCMCh), hydroxypropyltrimethyl ammonium chloride chitosan (HACC), cellulose nanofibers (CNC), and cellulose nanofibers (CNF). The influencing factors, such as molecular structure, concentration of additives and temperature on the rheological properties were studied, which results revealed the information intermolecular interactions. Based on the rheological properties, several systems were selected to prepare films, which show very good transparency, wettability, mechanical properties, biodegradability, and cytotoxicity. These good characteristics of the selected films also proved the good biocompatibility of CMC and chitosan and cellulose derivatives. This work will provide an idea to prepare CMC-based food packaging and effective drug delivery materials with specific properties.

Examining the clustering characteristics and fluctuations within urban areas during peak hours through the lens of bike-sharing is of utmost importance in the optimization of bike-sharing systems and urban transportation planning. This investigation adopts the principles of urban spatial interaction network construction and employs streets as the fundamental units of analysis to model bike-sharing activities during morning and evening peak hours within Beijing's six central districts. Subsequent to this, a comprehensive analysis of the network's structural attributes was carried out. A walktrap method rooted in modularity analysis was introduced to discern and scrutinize the clustering patterns and characteristics of communities within the network across different temporal intervals. Empirical findings reveal a predominant usage pattern of shared bicycles for short-distance travel during both morning and evening peak hours. Notably, distinctive community structures manifest during these periods, characterized by two large communities and multiple smaller ones during the morning peak, while the evening peak showcases a single large community alongside several medium-sized and smaller ones. Moreover, the extended interaction radius points to an expanded geographic range of interactions among streets. These findings bear significant implications for the management of urban transportation, bike-sharing enterprises, and urban residents, proffering valuable insights for the optimization of bike-sharing schemes and transportation strategies.

The parameter estimation problem for polynomial phase signals (PPSs) arises in a number of fields, including radar, sonar, biology, etc. In this paper, a fast algorithm of parameter estimation for monocomponent PPS is considered. We propose the so-called LSU-EKF estimator, which combines the least squares unwrapping (LSU) estimator and the extended Kalman filter (EKF). First, the coarse estimates of the parameters of PPS are obtained by the LSU estimator using a small number of samples. Subsequently, these coarse estimates are used to initial the EKF. Monte-Carlo simulations show that the computation complexity of the LSU-EKF estimator is much less than that of the LSU estimator, with little performance loss. Similar to the LSU estimator, the proposed algorithm is able to work over the entire identifiable region. Moreover, in the EKF stage, the accurate estimated results can be output point-by-point, which is useful in real applications.

We address weighted composition operators ψCφ from α-Bloch spaces to Bers-type spaces of bounded holomorphic functions on Y, where Y is a generalized Hua domain of the first kind, and obtain some necessary and sufficient conditions for the boundedness and compactness of those operators.

Conclusions: Molecular classification could provide reliable supplementary information for evaluating prognostic and contribute to treatment option decision-making in EEC patients. Fertility-sparing treatment is not recommended for EEC patients with CNH and MSI-H. Furthermore, fertility-sparing treatment can be attempted in EEC patients with CHL, but regular follow-up should be carried out to early detection of EC relapse and prevention of disease progression.

Oil and petroleum are strategic resources of great importance to national security. Petroleum and hydrothermal gold deposits may form together, with similar evolutionary trends in their formation, migration, and enrichment. Petroleum reservoirs and gold deposits are closely coupled under certain geological conditions. The solubility of gold in crude oil and its forms of occurrence are important in determining the mechanisms of interaction between gold and petroleum and in facilitating the recovery of gold from gold-bearing petroleum. In this study, the occurrence of gold in crude oil from the Linnan Depression in the Bohai Bay Basin, China, was studied using inductively coupled plasma–mass spectrometry and X-ray photoelectron spectroscopy. Concentrations of gold in crude oil from the Linpan and Shanghe oilfields averaged 44.5 ppb, which is well above the minimum concentration required for hydrothermal gold mineralization. Gold has an affinity with carbon, oxygen, and sulfur, and its concentration in crude oil is positively correlated with total acid and sulfur contents. We speculate that gold may exist in crude oil as complexes with organic acids or thiols, with crude oil thus being a transport medium for gold.

Background: Recently we demonstrated that Astragalus polysaccharide (PG2), the active ingredient in dried roots of astragalus membranaceus, ameliorates cancer symptom clusters and improve quality of life (QoL) in patients with metastatic disease by modulating inflammatory cascade, against the background that inflammatory cells including macrophages, dendritic cells (DCs), and cytotoxic T lymphocytes (CTLs) in tumor initiation, metastasis, and progression. Nevertheless, the role of PG2 in the modulation of anticancer immunogenicity and therapeutic response remains relatively underexplored and unclear. Purpose: The present study investigates how and to what extent PG2 modulates cellular and biochemical components of the inflammatory cascade, enhance anticancer immunity, and the therapeutic implication of same in patients with lung cancer. Methods and Results: Herein, we demonstrated that PG2 significantly increased the M1/M2 macrophage polarization ratio in non-small cell carcinoma (NSCLC) H441 and H1299 cells. This PG2-induced preferential pharmacologic up-regulation of tumoral M1 population in vitro, positively correlated with the downregulation of tumor-promoting IL-6 and IL-10 expression in NSCLC cell-conditioned medium, with concomitant marked inhibition of cell proliferation, clonogenicity and tumorsphere formation. Our ex vivo results, using clinical sample from our NSCLC cohort, demonstrated that PG2 also promoted the functional maturation of DCs with consequent enhancement of T cell-mediated anticancer immune responses. Consistent with the in vitro and ex vivo results, our in vivo studies showed that mice treated with PG2 exhibited significant time-dependent depletion of the tumor-associated M2 population, synergistically enhanced the anti-M2-based anticancer effect of cisplatin, and inhibition of xenograft tumor growth in the NSCLC mice models. Moreover, in the presence of PG2, cisplatin-associated dyscresia and weight-loss was markedly suppressed. Conclusion: These results do indicate a therapeutically-relevant role for PG2 in modulating the M1/M2 macrophage pool, facilitating DC maturation, and synergistically enhancing the anticancer effect of conventional chemotherapeutic agent, cisplatin; thus laying the foundation for further exploration of the curative relevance of PG2 as surrogate immunotherapy and/or clinical feasibility of its use for maintenance therapy in patients with lung cancer.

Mouse embryonic stem cells (mESCs) possess remarkable characteristics of unlimited self-renewal and pluripotency, which render them highly valuable for both fundamental research and clinical applications. A comprehensive understanding of the molecular mechanisms underlying mESC function is of utmost importance. The Human Silence Hub (HUSH) complex, comprising FAM208A, MPP8, and periphilin, constitutes an epigenetic silencing complex involved in suppressing retroviruses and transposons during early embryonic development. However, its precise role in regulating mESC pluripotency and differentiation remains elusive. In this study, we generated homogenous miniIAA7 tagged Mpp8 mouse ES cell lines. Upon induction of MPP8 protein degradation, we observed impaired proliferation and reduced colony formation ability of mESCs. Furthermore, this study unveils the involvement of MPP8 in regulating the activity of the LIF/STAT3 signaling pathway and Nanog expression in mESCs. Finally, we provide compelling evidence that degradation of the MPP8 protein impairs the differentiation of mESC.

Background: The pathophysiology of functional dyspepsia (FD) remains insufficiently understood, and the pain and economic constraints associated with endoscopic examinations hinder the precise definition and treatment of this disorder. Exploring the potential of multi-omics biomarkers for FD could yield promising targets for effectively diagnosing and treating this condition. Methods: We recruited 54 FD patients and 29 healthy volunteers and characterized their gut microbiota by shotgun metagenomic sequencing and their serum and urine metabolites by liquid chromatography-mass spectrometry (LC-MS). Results: We identified the changes in circulating metabolites associated with FD and linked to the gut microbial alterations. Among the differential circulating metabolites, we particularly highlighted the strong association of L-glutamate deficiency with the severity of FD symptoms and its strong predictive value for FD. Although no significant changes were noted in the gut microbial community structure of the FD samples, this might be attributed to symptom overlap between epigastric pain syndrome (EPS) and postprandial distress syndrome (PDS). However, significant alterations in the abundance of certain species were observed, including a substantial increase in the abundance of Streptococcus in the digestive tract of patients with FD. Finally, a cross-omics correlation network integrating metabolomic data with microbial community abundance was established, uncovering potential host-microbe-metabolite interactions. Conclusions: This work provides the first comprehensive description of the disrupted state of blood and urine metabolite composition and gut microbiota in patients with FD. These findings potentially offer promising targets for the diagnosis and treatment of this condition through a multi-omics approach, with particular emphasis on serum metabolomics.

Biogeography research is flawed by the poor understanding of microbial distributions due to the lack of a systematic research framework, especially regarding appropriate study units. By combining pure culture and molecular methods, we studied the biogeographic patterns of nematode-trapping fungi by collecting and analysing 2,250 specimens from 228 sites in Yunnan Province, China. We found typical watershed patterns at the species and genetic levels of nematode-trapping fungi. The results showed that microbial biogeography could be better understood by 1) using watersheds as research units, 2) removing the coverup of widespread species, and 3) applying good sampling efforts and strategies. We suggest that watersheds could help unify the understanding of the biogeographic patterns of animals, plants, and microbes and may also help account for the historical and contemporary factors driving species distributions.

The flow behavior of Fe-6.5wt.%Si alloys during hot compression was investigated at temperatures 650–950 °C and strain rates 0.01–10 s^-1. The results showed that the flow stress depended distinctly on the deformation temperatures and strain rates. The flow stress and work hardening rate increased with the decrease of temperature and the increase of strain rate. The activation energy under all the deformation conditions was calculated to be 410 kJ/mol. The constitutive equation with hyperbolic sine function and Zener–Hollomon parameter was developed. The peak stress, critical stress, and steady-state stress could be represented as σ=A+Bln(Z/A). Dynamic recrystallization occurred under the deformation conditions where the values of Z were lower than 10²⁰. Processing maps were established to optimize the processing parameters. The power dissipation efficiency decreased in the high temperature and low strain rate region, increased in the high temperature and high strain rate region, and remained unchanged in other regions with the increase of true strain. Furthermore, the unstable area expanded. The true strain of 0.7 was the optimum reduction according to the processing map. Based on the analysis of surface quality, microstructures, and ordered structures, the optimized processing parameters for the Fe-6.5wt.%Si alloys were the temperature and strain rate of higher than 900 °C and 0.01–10 s^-1, respectively, or 800–900 °C and lower than 0.4 s^-1, respectively.

The ridge-furrow plastic mulching (RFPM) system and nitrogen application have been effective strategies for improving crop productivity in the Loess Plateau of China. However, it is not clear how the ridge-furrow ratio and nitrogen fertilizer type (NT) affect the utilization of water, nitrogen, heat and radiation resources for increased rain-fed wheat production. Two nitrogen fertilizer types [Traditional urea (TU) and controlled-release urea (CRU)] and four planting patterns [conventional flat planting (F) and the RFPM system of 20 cm ridge with 40 cm furrow (R2F4), 40 cm ridge with 40 cm furrow (R4F4), and 60 cm ridge with 40 cm furrow (R6F4)] were tested from September, 2018 to June, 2021 during winter wheat growing season. The results showed that the RFPM system can increase the soil thermal time (TTsoil) by 41.0–152.1°C d compared to F. The thermal effect of the RFPM system shortens the vegetative growth period and extends the reproductive growth period by 2–7 days, promoting the increase of the leaf area index (LAI) and final dry matter (DM) accumulation. These significantly increased the grain yield (GY) in the RFPM system by 51.6–115.2% and enhanced the thermal time use efficiency (TUE) by 48–99.5%, water productivity (WP) by 37.4–76.3%, radiation use efficiency (RUE) by 16.3–34.4%, and partial factor productivity of nitrogen (PFPN) by 51.6–115.2% compared to F. Although a high ridge-furrow ratio combined with CRU increased GY and resources use efficiency, it also exacerbated the soil water depletion, especially in the 40–140 cm soil layer. Overall, applying CRU in combination with the RFPM system of 40 cm ridge with 40 cm furrow maximized resources use efficiency and increased wheat production in the Loess Plateau of China.