The achievement of reproductive competence in male mammals is dependent on the testis. Goat testis’ development and spermatogenesis involve physiological events with high complexity. In the current work, 6 testes were respectively collected from immature, sexually mature and physically mature Qianbei Ma goats (1, 6 and 12 months old, respectively). RNA-Seq was carried out to reveal changes in testis mRNA expression levels in Qianbei Ma goats at various developmental stages, and gene expression profiling at different ages was established. Totally 18 libraries were established for screening genes and pathways associated with testis development and spermatogenic processes. Totally 9,724 upregulated and 4,153 downregulated genes were identified between immature (I) and sexually mature (S) testes; 7 upregulated and 3 downregulated genes were detected between sexually mature (S) and physically mature (P) testes, and approximately 4% of genes were alternately spliced between the I and S groups. Selected genes were verified by qRT-PCR, in agreement with sequencing data indicating their reliability. Those genes have critical functions in various developmental stages of goat testicular development and spermatogenesis. Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway analyses were carried out to evaluate differentially expressed genes (DEGs). GO analysis suggested DEGs were involved in “reproduction process”, “channel activity” and “cell periphery part” between I and S, and in “ion transport process”, “channel activity” and “transporter complex part” between S and P. KEGG analysis indicated that pathways such as “glycerolipid metabolism”, “steroid hormone biosynthesis” and “MAPK signaling pathway” may be involved in testis development and spermatogenesis. Genes including IGF1, TGFB1, TGFBR1 and EGFR may regulate the development of the testis from immature to sexually mature, which may be key candidate genes for the development of goat testis. These findings provide novel insights into goat testicular development and spermatogenesis.

Glioblastoma (GBM) is the most common malignant brain tumor in adults. Despite advancements in treatment, the prognosis for patients with GBM remains poor due to its aggressive nature and resistance to therapy. CRISPR-based genetic screening has emerged as a powerful tool for identifying genes crucial for tumor progression and treatment resistance, offering promising targets for tumor therapy. In this review, we provide an overview of the recent advancements in CRISPR-based genetic screening approaches and their applications in GBM. We highlight how these approaches have been used to uncover genetic determinants of GBM progression and susceptibility to various therapies. Furthermore, we discuss ongoing challenges and future directions of CRISPR-based screening methods in advancing GBM research.

The mammalian or mechanistic target of rapamycin (mTOR) integrates multiple intracellular and extra-cellular upstream signals involved in the regulation of anabolic and catabolic processes in cells, and plays a key regulatory role in cell growth and metabolism. Activation of the mTOR signaling pathway has been reported to be associated with a wide range of human diseases. A growing number of in vivo and in vitro studies have demonstrated that the gut microbes and its complex metabolites can regulate host metabolic and immune responses through the mTOR pathway, and result in disorders of host phys-iological functions. In this review, we summarize the regulatory mechanisms of gut microbes and mTOR in different diseases, and discuss the crosstalk between gut microbes and their metabolites and mTOR in the disorders in gastrointestinal tract, liver, heart and other organs. We also discuss the promising appli-cation of multiple potential drugs that can adjust the gut microbiota and mTOR signal pathways. Despite the limited findings between gut microbes and mTOR, elucidating their relationship may provide new clues for the prevention and treatment of various diseases.

High mountain areas are an appropriate indicator of anthropogenic lead (Pb), which can reach the remote mountain ranges through long distance atmospheric transport. We compared the content of Pb in ecologically equivalent rodent species from Tian-Shan with European mountain ranges Tatra, Vitosha and Rila mountains. We used bone tissues from terminal tail vertebrae of small rodents for detection of Pb levels by using electrothermal atomic absorption spectroscopy (AAS). The tail bones of Tian-Shan rodents had significantly lower Pb levels than snow voles from Tatra mountains, but there was no significant difference in comparison with Vitosha and Rila mountains. We can conclude that Tian-Shan shows lower pollution by Pb than Tatra mountains, what may be a reason of longer lasting industrialization of north-western Europe and strongly prevailing west winds in Tatra mountains.

Water pollution, intensified by the release of hard-to-degrade pollutants, poses severe threats to ecosystems, human health, and economic development. The existing advanced oxidation processes often involve high operational costs and may result in secondary pollution, highlighting the necessity for innovative and more sustainable solutions. To address these challenges, our study introduces a cost-effective and eco-friendly corona discharge barrier plasma discharger for wastewater treatment. Through the central composite design/response surface methodology, a high decolorization rate of 98% of methylene blue (MB) within 10 minutes was achieved by optimizing parameters such as pH and voltage. Furthermore, the mechanisms of the generation of reactive oxygen species via this device was discussed in detail and the degradation pathways of MB were described. Moreover, this device is also very energy-efficient, with a low energy density and electrical energy per order of 0.15 watt/mL and 5.79 kWh/m³/order, respectively. In conclusion, the plasma discharger developed in this study provides a cost-effective and environmentally sustainable solution for dye wastewater treatment. This research contributes significantly to the advancement of sustainable dye wastewater management practices, offering an innovative method that meets both environmental and economic objectives.

Current numerical methods for simulating biophysical processes in aquatic environments are typically constructed in a grid-based Eulerian framework or as an individual-based model in a particle-based Lagrangian framework. Often, the biogeochemical processes and physical (hydrodynamic) processes occur at different time and space scales, and changes in biological processes do not affect the hydrodynamic conditions. Therefore, it is possible to develop an alternative strategy to grid-based approaches for linking hydrodynamic and biogeochemical models that can significantly improve computational efficiency for this type of linked biophysical model. In this work, we utilize a new technique which links hydrodynamic effects and biological processes through a property-carrying particle model (PCPM) in a Lagrangian/Eulerian framework. The model is tested in idealized cases and its utility is demonstrated in a practical application to Sandusky Bay. Results show the integration of Lagrangian and Eulerian approaches allows for a natural coupling of mass transport (represented by particle movements and random walk) and biological processes in water columns which is described by a nutrient-phytoplankton-zooplankton-detritus (NPZD) biological model. This method is far more efficient than traditional tracer based Eulerian biophysical models for 3-D simulation, particularly for a large domain and/or ensemble simulations.

Accurate measurement of systemic financial risk is critical to maintaining the stability of financial markets. Taking China as the subject of investigation, the Chinese Financial Stress Index (CFSI) indicator system was con-structed by integrating six dimensions and employing Gray Relation Analysis (GRA) for dimensionality reduction of the indicators. The CFSI was derived using the Attribute Hierarchy Model (AHM) method with the Criteria Importance Through the Intercriteria Correlation (CRITIC) method, and an Improved Gravitational Search Algorithm (IGSA) optimized Radial Basis Function Neural Network (RBFNN) was proposed for out-of-sample prediction of CFSI trends from 2024 to 2026. By analyzing the trend of financial pressure indicators, the relationship between financial pressure and economic activity can be effectively identified. The research findings indicate that: (1) The CFSI is capable of accurately reflecting the current financial stress situation in China; (2) The IGSA-RBFNN demonstrates good robustness and generalization capabilities, predicting that the CFSI index will reach a peak value of 0.543 by the end of 2024, and there exists a regular pattern of stress rebound towards the end of each year. The novel methodology benefits policymakers and regulatory authorities to formulate preventive measures and risk management by identifying potential risks and vulnerabilities in advance.

The radar sensor described realizes healthcare monitoring capable of detecting subject chest-wall movement caused by cardiopulmonary activities, and wirelessly estimating the respiration and heartbeat rates of the subject without attaching any devices to the body. Conventional single-tone Doppler radar can only capture Doppler signatures because of a lack of bandwidth information with noncontact sensors. In contrast, we take full advantage of impulse radio ultra-wideband (IR-UWB) radar to achieve low power consumption and convenient portability, with a flexible detection range and desirable accuracy. A noise reduction method based on improved ensemble empirical mode decomposition (EEMD) and a vital sign separation method based on the continuous-wavelet transform (CWT) are proposed jointly to improve the signal-to-noise ratio (SNR) in order to acquire accurate respiration and heartbeat rates. Experimental results illustrate that respiration and heartbeat signals can be extracted accurately under different conditions. This noncontact healthcare sensor system proves the commercial feasibility and considerable accessibility of using compact IR-UWB radar for emerging biomedical applications.

A complex square matrix $A$ is said to be Hermitian if $A= A^{\ast}$, the conjugate transpose of $A$. The topic of the present note is concerned with the characterization of Hermitian matrix. In this note, the we show that each of the two triple matrix product equalities $AA^{\ast}A = A^{\ast}AA^{\ast}$ and $A^3 = AA^{\ast}A$ implies that $A$ is Hermitian by means of decompositions and determinants of matrices, which are named the two-sided removal and cancellation laws associated with Hermitian matrix, respectively. We also present several general removal and cancellation laws as the extensions of the preceding two facts about Hermitian matrix.

Factorization reduces computational complexity and is therefore an important tool in statistical machine learning of high dimensional systems. Conventional molecular modeling, including molecular dynamics and Monte Carlo simulations of molecular systems, is a large research field based on approximate factorization of molecular interactions. Recently, the local distribution theory was proposed to factorize global joint distribution of a given molecular system into trainable local distributions. Belief propagation algorithms are a family of exact factorization algorithms for trees and are extended to approximate loopy belief propagation algorithms for graphs with loops. Despite the fact that factorization of probability distribution is their common foundation, computational research in molecular systems and machine learning studies utilizing belief propagation algorithms have been carried out independently with respective track of algorithm development. The connection and differences among these factorization algorithms are briefly presented in this perspective, with the hope to intrigue further development in factorization algorithms for physical modeling of complex molecular systems.

This note addresses a fundamental problem in matrix theory on establishing and characterizing range equalities for matrix expressions that involve generalized inverses. We first establish a group of necessary and sufficient conditions for the matrix range equality ${\rm range}(D_1 - C_1A_1^{\dag}B_1) = {\rm range}(D_2 - C_2A_2^{\dag}B_2)$ to hold, where $(\cdot)^{\dag}$ denotes the Moore--Penrose inverse of matrix. We then give several groups of range equalities with extrusion properties for multiple matrix products associated with two matrices and their conjugate transposes and Moore--Penrose inverses.

3,4-Dihydroquinolin-2(1H)-ones represent a class of valuable bioactive compounds with six-membered nitrogen-containing heterocyclic structures. The development of simple, mild and efficient synthetic methods has been widely concerned by synthetic chemists. In this review, we have summarized a series of different synthetic strategies for the synthesis of dihydroquinoline-2(1H)-ones via catalytic annulation of α,β-unsaturated N-arylamides in the past decade, including covering electrophilic cyclization, radical initiated cyclization and photochemical cyclization reactions. Besides, the substrate scope and mechanistic details are also discussed. This paper will provide a useful reference for the development of diverse synthesis methodologies of 3,4-dihydroquinolin-2(1H)-ones.

This article shows how to establish expansion formulas for calculating the mixed operations $(A^{\dag})^{\#}$, $(A^{\#})^{\dag}$, $((A^{\dag})^{\#})^{\dag}$, $((A^{\#})^{\dag})^{\#}$, $\ldots$ of generalized inverses, where $(\cdot)^{\dag}$ denotes the Moore--Penrose inverse of a matrix and $(\cdot)^{\#}$ denotes the group inverse of a square matrix. As applications of the formulas obtained, the author constructs and classifies some groups of matrix equalities involving the above mixed operations, and derives necessary and sufficient conditions for them to hold.

One of matrix equalities composed of multiple products of matrices and their generalized inverses is given by $A_1B_1^{-}A_2B_2^{-} \cdots A_kB_k^{-}A_{k+1}= A$ where $A_1$, $B_1$, $A_2$, $B_2$, $\ldots$, $A_k$, $B_k$, $A_{k+1}$, and $A$ are given matrices of appropriate sizes, and $B_1^{-}$, $B_2^{-}$, $\cdots$, $B_k^{-}$ are generalized inverses of matrices. The cases for $k = 1, 2$ and their special forms were properly approached in the theory of generalized inverses of matrices. In this note, the author presents an algebraic procedure to derive explicit necessary and sufficient conditions for the equality with $k = 3$ to always hold using certain rank equalities for the block matrices constructed by the given matrices, and then mention a key step of extending the previous work to a general situation.

Given a square matrix $A$, we are able to construct numerous equalities that involve reasonable mixed operations of $A$ and its conjugate transpose $A^{\ast}$, Moore--Penrose inverse $A^{\dag}$, and group inverse $A^{\#}$. Such kind of equalities can be generally represented in the equation form $f(A, \, A^{\ast}, A^{\dag}, A^{\#}) =0$. In this article, the author constructs a series of simple or complicated matrix equalities, as well as matrix rank equalities involving the mixed operations of the four matrices. As applications, we give a sequence of necessary and sufficient conditions for a square matrix to be range-Hermitian.

Kronecker products of matrices have some striking operation properties, one of which is called the mixed-product property $(A \!\otimes\! B)(C \!\otimes\! D) = AC \!\otimes\! BD$. In view of this property, the two-term Kronecker product $A_1 \otimes A_2$ can be rewritten as $A_1 \otimes A_2 = (A_1 \otimes I_{m_2})(I_{m_1} \otimes A_2)$ of dilation forms of $A_1$ and $A_2$, and three-term Kronecker product $A_1 \otimes A_2 \otimes A_3$ can be rewritten as the products $A_1 \otimes A_2 \otimes A_3 = (A_1\otimes I_{m_2} \otimes I_{m_3})(I_{m_1} \otimes A_2 \otimes I_{m_3})(I_{m_1} \otimes I_{m_2} \otimes A_3)$ of the dilation forms of $A_1$, $A_2$, and $A_3$, respectively, where the matrices on the right-hand sides of the two factorizations are commutative. In this note, we approach the commutative Kronecker products on the right-hand sides of the two factorization equalities, and present a variety of new and useful analytical formulas for calculating the ranks, dimensions, orthogonal projectors, and ranges of matrices composed of these Kronecker products.

This note reconsiders a matrix equality $A_1A_2^{-}A_3A_4^{-}A_5 = A$ composed by six matrices of appropriate sizes, where $A_2^{-}$ and $A_4^{-}$ are generalized inverses of $A_2$ and $A_4$, respectively, and solves a selection of matrix set inclusion problems associated with various mixed reverse order laws for generalized inverses of products of two, three, and four matrices by means of this equality and its variations.

It is a classic topic in algebras to construct and verify equalities that are composed of various algebraic operations of elements and their inverses or generalized inverses. In this note, the author constructs a matrix equality $(AB)^{\dag} = B^{\ast}(A^{\ast}ABB^{\ast})^{\#}A^{\ast}$ (called a mixed reverse-order law), where $A$ and $B$ are two matrices of appropriate sizes, $(\cdot)^{\ast}$, $(\cdot)^{\dag}$, and $(\cdot)^{\#}$ denote the conjugate transpose, the Moore--Penrose inverse, and the group inverse of a matrix, respectively, and shows that the mixed reverse-order law always holds. A list of variation forms of this matrix equality are also given, and necessary and sufficient conditions are obtained for them to hold. Especially, we show a remarkable fact that the two reverse-order laws $(AB)^{\dag} = B^{\dag}A^{\dag}$ and $(A^{\ast}ABB^{\ast})^{\#} = (BB^{\ast})^{\#}(A^{\ast}A)^{\#}$ are equivalent.

Reverse order laws for generalized inverses of matrix products is a classic object of study in the theory of generalized inverses. One of the well-known reverse order laws for a matrix product $AB$ is $(AB)^{(i,\ldots,j)} = B^{(s_2,\ldots,t_2)}A^{(s_1,\ldots,t_1)}$, where $(\cdot)^{(i,\ldots,j)}$ denotes an $\{i,\ldots, j\}$-generalized inverse of matrix. Because $\{i,\ldots, j\}$-generalized inverse of a singular matrix is unique, the relationships between both sides of the reverse order law can be divided into four situations for consideration. This paper provides a thorough coverage of the reverse order laws for $\{i,\ldots, j\}$-generalized inverses of $AB$, from the development of background and preliminary tools to the collection of miscellaneous formulas and facts on the reverse order laws in one place with cogent introduction and references for further study. We begin with the introduction of a linear mixed model $y = AB\beta + A\gamma + \epsilon$ and the presentation of two least-squares methodologies to estimate the fixed parameter vector $\beta$ in the model, and the description of connections between the two types of least-squares estimators and the reverse order laws for generalized inverses of $AB$. We then prepare some valued matrix analysis tools, including a general theory on linear or nonlinear matrix identities, a group of expansion formulas for calculating ranks of block matrices, two groups of explicit formulas for calculating the maximum and minimum ranks of $B^{(s_2,\ldots,t_2)}A^{(s_1,\ldots,t_1)}$, as well as necessary and sufficient conditions for $B^{(s_2,\ldots,t_2)}A^{(s_1,\ldots,t_1)}$ to be invariant with respect to the choice of $B^{(s_2,\ldots,t_2)}A^{(s_1,\ldots,t_1)}$. We then present a unified approach to the 512 matrix set inclusion problems associated with the above reverse order laws for the eight commonly-used types of generalized inverses of $A$, $B$, and $AB$ through use of the definitions of generalized inverses, the block matrix method (BMM), the matrix rank method (MRM), the matrix equation method (MEM), and various algebraic calculations of matrices.

Quality assurance has been one of the major challenges in laser-based additive manufacturing (AM) processes. This study proposes a novel process modeling methodology for layer-wise in-situ quality monitoring based on image series analysis. An image-based autoregressive (AR) model has been proposed based on the image registration function between consecutively observed thermal images. Image registration is used to extract melt pool location and orientation change between consecutive images, which contains sensing stability information. Subsequently, a Gaussian process model is used to characterize the spatial correlation within the error matrix. Finally, the extracted features from the aforementioned processes are jointly used for layer-wise quality monitoring. A case study of a thin wall fabrication by a Directed Laser Deposition (DLD) process is used to demonstrate the effectiveness of the proposed methodology.

Achieving sustainable management of forests in China is becoming increasingly important with more awareness and realization of the importance of forests in environmental protection. Forest certification, a market-based instrument to promote sustainable forest management, has been recognized by many countries including China. While landowners’ perception and perspective regarding this voluntary program have been well-documented in literature, how to motivate and incentivize landowners to participate in forest certification remained under-studied questions. With the face-to-face survey of landowners in Shandong, China, this study analyzed landowners’ willingness to accept compensation for participating in forest certification. Results indicated that landowners average accepted compensation, in terms of increased timber price, was about RMB120 (~$17.2)/m3 to have their forests certified. Results from multiple regression showed that the level of such compensation required for certification adoption was influenced by ownership size, owners’ demographics, certification program requirements, as well as importance placed on timber sale. These findings would inform policy-makers in designing compensation-related polices and establish incentive-based mechanisms to motivate landowners participate in forest certification programs in China.

Molecular modeling is widely utilized in subjects including but not limited to physics, chemistry, biology, materials science and engineering. Impressive progress has been made in development of theories, algorithms and software packages. To divide and conquer, and to cache intermediate results have been long standing principles in development of algorithms. Not surprisingly, Most of important methodological advancements in more than half century of molecule modeling are various implementations of these two fundamental principles. In the mainstream classical computational molecular science based on force fields parameterization by coarse graining, tremendous efforts have been invested on two lines of algorithm development. The first is coarse graining, which is to represent multiple basic particles in higher resolution modeling as a single larger and softer particle in lower resolution counterpart, with resulting force fields of partial transferability at the expense of some information loss. The second is enhanced sampling, which realizes "dividing and conquering" and/or "caching" in configurational space with focus either on reaction coordinates and collective variables as in metadynamics and related algorithms, or on the transition matrix and state discretization as in Markov state models. For this line of algorithms, spatial resolution is maintained but no transferability is available. Deep learning has been utilized to realize more efficient and accurate ways of "dividing and conquering" and "caching" along these two lines of algorithmic research. We proposed and demonstrated the local free energy landscape approach, a new framework for classical computational molecular science and a third class of algorithm that facilitates molecular modeling through partially transferable in resolution "caching" of distributions for local clusters of molecular degrees of freedom. Differences, connections and potential interactions among these three algorithmic directions are discussed, with the hope to stimulate development of more elegant, efficient and reliable formulations and algorithms for "dividing and conquering" and "caching" in complex molecular systems.

In this note, we provide some effective treatments of a general linear model with adding-up restrictions via algebraic operations of given vectors and matrices in the model, including analytic expressions of the well-known ordinary least-squares estimator (OLSE) and the best linear unbiased estimator (BLUE) of the unknown parameters in the model.

This note shows that the well-known reverse order law $(AB)^{\dag} = B^{\dag}A^{\dag}$ for the Moore--Penrose inverse of matrix product is equivalent to many other equalities for that are composed of multiple products $(AB)^{\dag}$ and $B^{\dag}A^{\dag}$ by means of the definition of the Moore--Penrose inverse and orthogonal projector theory.

The black hole information paradox is one of the most puzzling paradoxes in physics. Black holes trap everything that falls into them, while their mass may leak away through purely thermal Hawking radiation. When a black hole vanishes, all the information locked inside, if any, is just lost, thus challenging the principles of quantum mechanics. However, some information does have a way to escape from inside the black hole, that is, through gravitational waves. Here, a concise extension of this notion is introduced. When a black hole swallows something, whether it is a smaller black hole or an atom, the system emits gravitational waves carrying the information about the “food”. Although most of the signals are too weak to be detected, the information encoded within them will persist in the universe. This speculation provides an explanation for a large part, if not all, of the supposed “information loss” in black holes, and thus reconciles the predictions of general relativity and quantum mechanics.

One of the typical forms of linear matrix expressions (linear matrix-valued functions) is given by $A + B_1X_1C_1 + \cdots + B_kX_kC_k$, where $X_1, \ldots, X_k$ are independent variable matrices of appropriate sizes, which include almost all matrices with unknown entries as its special cases. The domain of the matrix expression is defined to be all possible values of the matrix expressions with respect to $X_1, \ldots, X_k$. I this article, we approach some problems on the relationships between the domains of two linear matrix expressions by means of the block matrix method (BMM), the matrix rank method (MRM), and the matrix equation method (MEM). As application, we discuss some topics on the relationships among general solutions of some linear matrix equations and their reduced equations.

Land surface temperature (LST) is a critical parameter for the dynamic simulation of land surface processes and for analyzing variations on regional or global scales. Obtaining LST with high spatiotemporal resolution is a subject of intensive and ongoing research. This study proposes a pixel-wise temporal alignment iterative linear regression model for downscaling based on MODIS LST products. This approach allows us to address the problem of high temporal resolution but low spatial resolution of the ERA5 reanalysis LST product, while remaining immune to pixel loss caused by clouds. The hourly ERA5 LST of the study area for 2012–2021 was downscaled to 1000 m resolution, and its accuracy was verified by comparison with measured data from meteorological stations. The downscaled LST offers intricate details and is faithful to the LST characteristics of distinct land-cover categories. In comparison with other downscaling techniques, the proposed technique is more stable and preserves the spatial distribution of ERA5 LST with minimal missing pixels. The pixel-wise average R-squared and mean absolute error for MODIS view times are 0.87 and 2.7 K, respectively, for cloud-free conditions at a 1000 m scale. Accuracy verification using data from meteorological stations indicates that the overall error is lower during cloudless periods rather than during overcast periods, during the night rather than during the day, and at MODIS view times rather than at non-view times. The maximum and minimum mean errors are 0.13 K for cloud-free periods and −0.98 K for cloudy periods, indicating a slight underestimation and overestimation, respectively. Conversely, the maximum and minimum mean absolute errors are 2.01 K for the daytime and 0.85 K for the nighttime. Therefore, the model ensures higher accuracy during cloudy periods with only clear sky LST as input data, making it suitable for long-term, all-weather ERA5 LST downscaling.

Although Eulerian approaches are standard in computational acoustics, they are less effective for certain classes of problems like bubble acoustics and combustion noise. A different approach for solving acoustic problems is to compute with individual particles following particle motion. In this paper, a Lagrangian approach to model sound propagation in moving fluid is presented and implemented numerically, using three meshfree methods to solve the Lagrangian acoustic perturbation equations (LAPE) in the time domain. The LAPE split the fluid dynamic equations into a set of hydrodynamic equations for the motion of fluid particles and perturbation equations for the acoustic quantities corresponding to each fluid particle. Then, three meshfree methods, the smoothed particle hydrodynamics (SPH) method, the corrective smoothed particle (CSP) method, and the generalized finite difference (GFD) method, are introduced to solve the LAPE and the linearized LAPE (LLAPE). The SPH and CSP methods are widely used meshfree methods, while the GFD method based on the Taylor series expansion can be easily extended to higher orders. Applications to modeling sound propagation in steady or unsteady fluids in motion are outlined, treating a number of different cases in one and two space dimensions. A comparison of the LAPE and the LLAPE using the three meshfree methods is also presented. The Lagrangian approach shows good agreement with exact solutions. The comparison indicates that the CSP and GFD method exhibit convergence in cases with different background flow. The GFD method is more accurate, while the CSP method can handle higher Courant numbers.

The photoelectrochemical (PEC) conversion of organic small molecules offers a dual benefit of synthesizing value-added chemicals and concurrently producing hydrogen (H2). Ethylene glycol, with its dual hydroxyl groups, stands out as a versatile organic substrate capable of yielding various C1 and C2 chemicals. In this study, we demonstrate that pH modulation markedly enhances the photocurrent of BiVO4 photoanodes, thus facilitating the efficient oxidation of ethylene glycol while simultaneously generating H2. Our findings reveal that in a pH=1 ethylene glycol solution, the photocurrent density at 1.23 V vs. RHE can attain an impressive 7.1 mA cm−2, significantly surpassing the outputs in neutral and highly alkaline environments. The increase in photocurrent is attributed to the augmented adsorption of ethylene glycol on BiVO4 under acidic conditions, which in turn elevates the activity of the oxidation reaction, culminating in the maximal production of formic acid. This investigation sheds light on the pivotal role of electrolyte pH in the PEC oxidation process and underscores the potential of the PEC strategy for biomass valorization into value-added products alongside H2 fuel generation.

Q345 steel is widely used in the construction industry, vehicle manufacturing industry, bridge construction industry and many other aspects due to its excellent comprehensive performance. However, due to its high silicon content, direct hot-dip galvanizing will lead to a series of problems, such as easy peeling of the coating due to the "silicon reactivity". In this paper, we adopt the "two-step hot-dipping method", first hot-dip aluminizing and then hot-dip galvanizing, to isolate the substrate and zinc liquid direct contact, so as to avoid the occurrence of "silicon reactivity". Through the microstructure characterization, neutral salt spray corrosion experiments, electrochemical experiments, the results show that: Al-Zn composite coatings from the inside out were perpendicular to the substrate growth of loose Fe2Al5 layer and Al-Zn layer, outbursts generation; Al-Zn composite coatings resistance to neutral salt spray corrosion was far more than the substrate; Al-Zn composite coatings polarization curve corrosion potential than the substrate was lower than that of the substrate by 0.512V, showing a strong corrosion resistance. It shows extremely strong corrosion resistance.

Background: The COVID-19 outbreak has accelerated the huge difference between medical care and disease prevention in Chinese medical institutions. This study aimed to investigated the relationship between the symbiotic units, environments, models, and effects of the integration of medical and disease prevention. Methods: This cross-sectional study involved 762 employees of public hospitals in 11 cities in Zhejiang Province by random stratified sampling. We analyzed the influence paths of elements in the mechanism of integration of medical and disease prevention and the mediating effect of symbiotic models among symbiotic units, symbiotic environments, and effects for on this integration. Results: The path coefficient of symbiotic unit on the symbiosis model was 0.46 (p<.001), the path coefficient of symbiotic environment on symbiosis model was 0.52 (p<.001). The path coefficient of the symbiotic unit and environment was 0.91 (p<.001). The symbiotic models exhibited a partial mediation effect between symbiotic units and the effect of this integration. Sobel test = 3.27, β = 0.152, and the mediating effect accounted for 34.6%. Conclusions: It is suggested that Health policy-makers and public hospital managers should provide sufficient symbiotic units, establish collaborative symbiotic models, and improve the effects of integration of medical and disease prevention in public hospitals.

In this paper we totally discard the traditional trial-and-error algorithms of choosing acceptable shape parameter c in the multiquadrics $-\sqrt{c^{2}+\|x\|^{2}}$ when dealing with differential equations. Instead, we choose c directly by the MN-curve theory and hence avoid the time-consuming steps of solving a linear system required by each trial of the c value in the traditional methods. The quality of the c value thus obtained is supported by the newly born choice theory of the shape parameter. Experiments show that the approximation error of the approximate solution to the differential equation is very close to the best approximation error among all possible choices of c.

The traditional Chinese drug Bombyx Batryticatus mori.L (BBm) which is also named the white stiff silkworm has been widely used in Chinese clinics for thousands of years. It is famous for its antispasmodic and blood circulation promoting effects. Cardiomyocyte hypertrophy, interstitial cell hyperplasia and myocardial fibrosis are closely related to the N-glycosylation of key proteins. To examine the alterations of N-glycosylation that occur in diabetic myocardium during the early stage of the disease and clarify the therapeutic effect of 1-DNJ extracted from BBm, we used the db/db mouse model and an approach based on hydrophilic chromatography solid-phase extraction integrated with an LC-MS/MS identification strategy to perform a site-specific N-glycosylation analysis of left ventricular cardiomyocyte proteins. AGEs, hydroxyproline, CTGF and other serum biochemical indicators were measured with ELISA. In addition, the α1,6-fucosylation of N-glycans was profiled with LCA lectin blots and FITC-labelled lectin affinity histochemistry. The results indicated that 1-DNJ administration obviously downregulated myocardium protein N-glycosylation in db/db mice. The expression levels of serum indicators and fibrosis-related cytokines were reduced significantly by 1-DNJ in a dose-dependent manner. The glycan α1,6-fucosylation level of the db/db mouse myocardium was elevated, and the intervention effect of 1-DNJ administration on N-glycan α1,6-fucosylation was significant. To verify this result, the well-known TGF-β/smad2/3 pathway was selected, and core α1,6-fucosylated TGFR-βⅡ was analysed semi-quantitatively with western blotting. The result supported the conclusions obtained from LCA lectin affinity histochemistry and lectin blot analysis. The expression level of FUT8 mRNA was also detected, and the results showed that 1-DNJ administration did not cause obvious inhibitory effects on FUT8 expression. Therefore, the mechanism of 1-DNJ to relieve the DCM-associated fibrosis can be concluded as the inhibition of N-GlcNAc formation and the reduction of substrate concentration.

Endotoxins are toxic substances that widely exist in the environment and can enter the intestine with food and other substances. Intestinal epithelial cells are protected by a mucus layer that contains MUC2 as its main structural component. However, a detailed understanding of the mechanisms involved in the function of the mucus barrier in endotoxin penetration is lacking. Here, we established the most suitable proportion of Caco-2/HT-29 co-culture cells as a powerful tool to evaluate the intestinal mucus layer. Our findings significantly advance current knowledge as focal adhesion and ECM-receptor interaction were identified as the two most significantly implicated pathways in MUC2 small interfering RNA (siRNA)-transfected Caco-2/HT-29 co-culture cells after 24 h of LPS stimulation. When the mucus layer was not intact, LPS was found to damage the tight junctions of Caco-2/HT29 co-cultured cells. Furthermore, LPS was demonstrated to inhibit the integrin-mediated focal adhesion structure and damage the matrix network structure of the extracellular and actin microfilament skeletons. Ultimately, LPS inhibited the interactive communication between the extracellular matrix and the cytoskeleton for 24 h in the siMUC2 group compared with the LPS(+) and LPS(-) groups. Overall, we recognized the potential of MUC2 as a tool for barrier function in several intestinal bacterial diseases.

Background: Coronavirus disease (COVID-19) related pneumonia is leaded by Severe Acute Respiratory Syndrome Coronavirus 2 (SARS-CoV-2), which infects host cells through receptors named Angiotensin-converting enzyme 2 (ACE2). Smoking is thought to be related to poor disease prognosis, as a large amount of evidence highlights the negative effects of smoking on lung health and its causal relationship with various respiratory diseases. Methods: We first evaluated the role of ACE2 expression level with tobacco effect. And correlation analyses were used to identify the related genes of ACE2 both in smoker trait and human normal multi-tissues. After intersections, hub genes were later used to further GSEA and co-regulated mechanisms were explored by GeneMANIA. We used UALCAN to perform survival curves of pan-cancers included 33 types of cancers. New clinical model of top co-occurrence cancer type was constructed and validated. Results: Effected by cigarette smoking, the expression level of ACE2 expressed statistically upwards in current smokers compared with never smokers, upwards in groups after acute smoke exposed compared with normal control. But no strong evidence detected in third-hand smoke, as poor amounts of samples, only 4. A little trend of expressing upwards became in groups after third-hand smoke compared with groups after clean air exposing. 4 genes included PIR, ADH7, AKR1C2 and AKR1C3 were identified as ACE2 related genes in smoker trait and human normal multi-tissues. Then, we made the survival curves of pan-cancers in 4 genes. Brain lower grade glioma was the co-occurrence type as both ACE2, PIR and AKR1C3 had the significantly prognostic situation. Later, we made the new clinical prediction model as the C-index was 0.827 and the Area Under Curves (AUCs) of 1-year survival, 2-year survival and 3-year survival were 0.921(95%CI, 0.882-0.961), 0.911(95%CI, 0.860-0.962) and 0.878(95%CI, 0.818-0.939). In inner validation, the AUCs of 1-year survival, 2-year survival and 3-year survival were 0.777(95%CI, 0.640-0.914), 0.916(95%CI, 0.842-0.990) and 0.888(95%CI, 0.768-1.000). In outer validation one, the AUCs of 1-year survival, 2-year survival and 3-year survival were 0.764(95%CI, 0.672-0.856), 0.848(95%CI, 0.783-0.913) and 0.748(95%CI, 0.656-0.841). And in outer validation two the AUCs of 1-year survival, 2-year survival and 3-year survival were 0.740(95%CI, 0.654-0.826), 0.766(95%CI, 0.688-0.843) and 0.794(95%CI, 0.721-0.866). Conclusions: In our study, we compared the ACE2 expression level between smokers and non-smokers crowds and identified associated hub genes. Then we explored the further role of hub genes in tumor fields to identify the correlation and influence between the avoidable host factors such as smoking on COVID-19 contamination and tumor. ACE2 and AKR1C3 are potential prognostic genes for brain lower grade glioma, and we created the web dynamic nomogram and encapsulation app through validations.

Objective: To use the ancient and modern medical record cloud platform (V2.3.5) to organize and explore the medication patterns of the "Three Causes, Extremity, and One Disease Syndrome Formula" by Chen Wuxuan, and to summarize its therapeutic ideas. Method: Collect and organize the "San Yin Si Tian Fang" in the "San Yin Ji Yi Zheng Fang Lun", and use the modern medical record cloud platform (V2.3.5) to conduct medication frequency statistical analysis, cluster analysis, and complex network analysis. As a result, a total of 16 Chinese herbal medicines were collected in the "Three Causes, Extreme and One Disease Syndrome Formula", involving 75 traditional Chinese medicines. Statistical analysis showed that roasted licorice was the most commonly used, followed by Pinellia ternata, papaya, ginger, and Poria cocos; Medications mainly include warm drugs, sweet and pungent flavors, as well as drugs that promote lung and spleen meridians. Cluster analysis can divide the above-mentioned traditional Chinese medicine into two groups, with specific grouping as follows. Group 1: ginger, white peony, aconite, papaya, and achyranthes bidentata; Group 2: roasted licorice, poria cocos, dried ginger, pinellia ternata, and green peel. Conclusion: The characteristics of the 16 prescriptions are biased towards Xin Gan Wen, emphasizing the regulation of the spleen and stomach, which may be related to the common use of prescription by doctors in the Song Dynasty and the tendency towards warm and dry medication.

Disparities between fold amplitude (A) and intrusion thickness (Hsill) are critical in identifying elastic or inelastic deformation in a forced fold. However, accurate measurement of these two parameters is challenging because of the limit in separability and detectability for the seismic data. In the TZ-47 exploring area from the Tarim Basin, Northwest China, we combined wireline data and 3-D seismic data, to accurately constrain the fold amplitude and total thickness of sills that inducing the roof uplift. The measurement results show that the forced fold amplitude is 155 m and the total sill thickness is 148.4 m. When using a magma density of 2.7 g/cm3, and solid rock density of 3 g/cm3, the molten magma thickness at the time of intrusion would be 153.8 m, which is almost no difference from the forced fold amplitude. Therefore, the TZ-47 fold is a pure elastic forced fold induced by emplacement of multiple sills. Measurement solely based on seismic data may not be able to detect some thin interlayers and may result in large errors.

Hexabromocyclododecane (HBCD) was most important flame retardant in Expanded Polystyrene foam and Extruded Polystyrene foam in the past forty years in the world. China was the major producer and user of HBCD, and the total HBCD production was about 0.3 million tons. Although HBCD has been completely banned in China in 2021 because of its long-range transport, bioaccumulation and toxicity, there's still a lot of residues in environment. Therefore, we reviewed multiple studies concerning the distribution of HBCD in diverse environmental matrices, such as air, dust, soil, water, sediment and biota. Results revealed that HBCD levels in different environments in China present a geographical variation and were at high level compared with other countries. In all environmental media, relatively high HBCD concentrations have been found in industrial and urban areas. Industrialization and urbanization are two important factors that influence the concentration and distribution of HBCD in the environment. In terms of isomer, γ-HBCD was the dominant isomer in soil, water, and sediment, while in the biota, α-HBCD was the predominant isomer.

In the paper, a fully discrete compact difference scheme with $O(\tau^{2}+h^{4})$ precision is established by considering the numerical approximation of the one-dimensional Allen-Cahn equation. The numerical solutions satisfy discrete maximum principle under reasonable step ratio and time step constraint is proved. And the energy stability for the fully discrete scheme is investigated. An example is finally presented to show the effectiveness of scheme.

Extracellular vesicles (EVs) are emerging mediators of intracellular and inter-organ communications in cardiovascular diseases (CVDs), especially in the pathogenesis of heart failure through the transference of EV-containing bioactive substances. microRNAs (miRNAs) are contained in EV cargo and are involved in the progression of heart failure. Over the past several years, a growing body of evidence has suggested that the biogenesis of miRNAs and EVs are tightly regulated, and the sorting of miRNAs into EVs is highly selective and tightly controlled. Extracellular miRNAs, in particular circulating EV-miRNAs, have shown promising potential as prognostic and diagnostic biomarkers for heart failure and as therapeutic targets. In this review, we summarize the latest progress concerning the role of EV-miRNAs in HF and their application in a therapeutic strategy development for heart failure.

The potential effect of implementing environmental regulations on economic growth is a controversial issue for a long time. As portrayed by Porter hypothesis, environmental regulations may impact on economic growth by reconstructing the economic structure. A number of previous literature proved the connections between the above three parties. With the intention of exploring the nature of this mechanism, it is important to understand the internal inter-relation of the three parties, requiring data from a large economy experiencing the transition in economic structure. By constructing a panel containing data from 30 Chinese provinces over 10 years (2008-2019), this paper investigate the dynamic inter-relation of the three parties by introducing PVAR model with Granger Test. Results reveal that environmental regulations give a “U” shaped impact to economic growth. In return, economic growth promotes the development of economy with a weakening strength. In addition, results also support the hypothesis that economic structure is the intermediate of economic growth and environmental regulations. There is a rooftop for the effect of economic structure to environmental regulations. The rooftop may signify the best optimization of primary structure.

Dielectric elastomers, such as thermoplastic polyurethanes (TPU), are widely used as dielectric layer, emulation layer and substrate of flexible and stretchable devices. To construct capacitors and actuators that work stably upon deformation, it has become an urgent need to investigate the evolution of dielectricity under stress and strain. However, the lack of effective methods for estimating the dielectric constant of elastomers under strain poses a big challenge. This article reports a device for in-situ measuring the dielectric constant of TPU under strain. It is found that upon stretching TPU to a strain of 400%, its dielectric constant decreases from 8.47 to 2.94. In addition, combined Fourier-transform infrared spectroscopy, X-ray scattering technique, and atomic force microscopy have been utilized to characterize the evolution of microstructure under strain. The investigation under tensile strain reveals that a decreased density and average size of polarized hard domains, along with a tendency of the molecular chains to align in parallel with the tensile stress. The evolution of the microstructures results in a reduction of the dielectric constant parallel to the electric field in TPU. Our work provides valuable experimental reference for improving the stability of flexible sensors and actuators based on dielectric elastomers.

In this research, catalytic steam reforming acetic acid derived from the aqueous portion of bio-oil for hydrogen production was investigated by using different Ni/ATC (Attapulgite Clay) catalysts prepared by precipitation, impregnation and mechanical blending methods. The fresh and reduced catalysts were characterized by XRD, N₂ adsorption-desorption, TEM and H₂-TPR. The comprehensive results demonstrated that the interaction between active metallic Ni and ATC carrier was significantly improved in Ni/ATC catalyst prepared by precipitation method, and in which the mean Ni particle size was the smallest (~13 nm) resulted in the highest metal dispersion (7.5%). The catalytic performance of the three catalysts was evaluated through the process of steam reforming of acetic acid in a fixed-bed reactor under atmospheric pressure at two different temperatures, such as 550 ℃ and 650 ℃. Results showed that the Ni/ATC (PM-N/ATC) prepared by precipitation method, achieved the highest H₂ yield of ~82% and little lower acetic acid conversion efficiency of ~85% than that (~95%) of Ni/ATC (IM-NATC) prepared by impregnation method. In addition, the deactivation catalysts after reaction for 4 h were analyzed by XRD, TGA-DTG and TEM, which demonstrated that the catalyst deactivation was not caused by the amount of carbon deposition, but owed to the significant agglomeration and sintering of Ni particles in the carrier.

The rapid growth of equipment tasks in 5G large-scale machine-type communication scenarios presents challenges due to user equipment’s (UE) limited computing power and power constraints. To address these limitations, task offloading to unmanned aerial vehicles (UAVs) has gained attention. However, traditional cloud computing centres far from the UE fail to meet latency requirements. Mobile Edge Computing (MEC) emerges as a solution by deploying computing servers at the edge of the cellular network to enhance service responsiveness. However, traditional MEC solutions need more flexibility. This paper explores the advantages of UAVs, including flexibility and rapid deployment, and considers UAV power constraints. It proposes a joint optimization approach for user offloading strategies and UAV trajectories to minimize the overall energy consumption of UE. By leveraging the benefits of UAVs and MEC, the proposed method aims to improve task execution efficiency in energy-constrained 5G machine-type communication scenarios.

Wenchuan earthquake that occurred in China in 2008 caused severe damage to a large number of electric substations. In this paper, Kriging interpolation method was used to calculate the impact area of the instrumental seismic intensity in Wenchuan earthquake, and to compare the intensities based on strong motion observation against the instrumental seismic intensities at locations where the observation data is available. The instrumental seismic intensities were calculated for the Wenchuan Earthquake at substations in the national power grid with voltage of 110kV or higher in areas of Mianyang, Deyang, Guangyuan and Chengdu. The cumulative Gaussian distribution function was then used to fit the relationship of the curves of the damage probabilities of high-voltage electrical equipment such as transformers, voltage mutual inductors, current mutual inductors, circuit breakers, isolating switches and lightning arrester with their instrumental seismic intensities. The damage probability density distribution curve of high-voltage electrical equipment based on the instrumental seismic intensities was obtained. The results showed that: (1) In the lower seismic intensity region, the mean instrumental seismic intensity was in good agreement with the traditional seismic intensity, but there was noticeable dispersion; in regions of intensity IX and above, the instrumental intensity was lower than the seismic intensity, but there was a lower degree of dispersion. (2) Among high-voltage electrical equipment, the transformers were most vulnerable to damage and they had some damage even under lower instrumental intensity. More damage would be produced when the instrumental intensity reached VIII or above; the second most vulnerable equipment was the circuit breaker, and the damage was most likely to occur when the instrument intensity was IX or above . (3) The damage rate curves of lightning arresters, current mutual inductors, voltage mutual inductors and isolating switches were relatively close to each other and the damage probability was the highest when the instrumental intensity was about X.

Wenchuan earthquake that occurred in China in 2008 caused severe damage to a large number of electric substations. In this paper, Kriging interpolation method was used to calculate the impact area of the instrumental seismic intensity in Wenchuan earthquake, and to compare the intensities based on strong motion observation against the instrumental seismic intensities at locations where the observation data is available. The instrumental seismic intensities were calculated for the Wenchuan Earthquake at substations in the national power grid with voltage of 110kV or higher in areas of Mianyang, Deyang, Guangyuan and Chengdu. The cumulative Gaussian distribution function was then used to fit the relationship of the curves of the damage probabilities of high-voltage electrical equipment such as transformers, voltage mutual inductors, current mutual inductors, circuit breakers, isolating switches and lightning arrester with their instrumental seismic intensities. The damage probability density distribution curve of high-voltage electrical equipment based on the instrumental seismic intensities was obtained. The results showed that: (1) In the lower seismic intensity region, the mean instrumental seismic intensity was in good agreement with the traditional seismic intensity, but there was noticeable dispersion; in regions of intensity IX and above, the instrumental intensity was lower than the seismic intensity, but there was a lower degree of dispersion. (2) Among high-voltage electrical equipment, the transformers were most vulnerable to damage and they had some damage even under lower instrumental intensity. More damage would be produced when the instrumental intensity reached VIII or above; the second most vulnerable equipment was the circuit breaker, and the damage was most likely to occur when the instrument intensity was IX or above . (3) The damage rate curves of lightning arresters, current mutual inductors, voltage mutual inductors and isolating switches were relatively close to each other and the damage probability was the highest when the instrumental intensity was about X.

Background: With the trend of intelligent display, the interface design of in-vehicle HUD is an expanding research field; Methods: To solve the subjectivity and uncertainty in the optimization of HUD interface design schemes, this paper proposed a hybrid scheme evaluation and optimization method based on entropy weight and VIKOR. The entropy weight method was used to reduce the subjectivity the decision-maker's weighting and obtain the objective weight of each indicator; The VIKOR method was used to obtain the best ranking of alternative schemes, and then the optimal interface design scheme was selected; Results: The evaluation of in-vehicle HUD interface design schemes were taken as an example for verification and calculation. The results showed that this method considers the subjectivity and uncertainty of the decision-making process in the optimization of design scheme, which can effectively improve the objectivity and accuracy of the evaluation results, and provide a reference for designers to optimize interface design schemes.

Second messengers, cyclic adenosine 3'-5'-monophosphate (cAMP) and cyclic guanosine 3'-5'-monophosphate (cGMP) are playing important roles in many animal cells by regulating intracellular signaling pathways and modulating cell physiology. Environmental cues like temperature, light and chemical compounds can stimulate cell surface receptors and trigger the generation of second messengers and the following regulations. Spread of cAMP and cGMP is further shaped by cyclic nucleotide phosphodiesterases (PDEs) for orchestration of intracellular microdomain signaling. However, localized intracellular cAMP and cGMP signaling requires further investigation. Optogenetic manipulation of cAMP and cGMP offers new opportunities of spatio-temporally precise study of their signaling mechanism. Light-gated nucleotide cyclases are well developed and applied for cAMP/cGMP manipulation. Recently discovered rhodopsin phosphodiesterase gene from protists established new and direct biological connection between light and PDEs. Light-regulated PDEs are under development and of demand to complete the toolkit of cAMP/cGMP manipulation. In this review, we summarize the state of the art, pros and cons of artificial and natural light-regulated PDEs and discuss potential new strategies of developing light-gated PDEs for optogenetic manipulation.

Understanding the distribution in drought and floods plays an important role in disaster risk management. The present study aims to explore the trends in the standardized precipitation index and extreme precipitation days in China, as well as to estimate the economic losses they cause. We found that in the Northeast China, northern of North China and northeast of Northwest China were severely affected by drought disasters (average damaged areas were 6.44 million hectares) and the most severe drought trend was located in West China. However, in the north of East China and Central China, the northeastern of the Southwest China was severely affected by flood disasters (average damaged areas were 3.97 million hectares) and the extreme precipitation trend is increasing in the northeastern of the Southwest China. In the Yangtze River basin, there were increasing trends in terms of drought and extreme precipitation, especially in the northeastern of the Southwest China, where accompanied by severe disaster losses. By combining the trends in drought and extreme precipitation days with the distribution of damaged areas, we found that the increasing trend in droughts shifted gradually from north to south, especially in the Southwest China, and the increasing trend in extreme precipitation gradually shifted from south to north.

Wide bandgap semiconductors-based photocatalysts are usually limited by their low solar energy conversion efficiency due to their limited absorption solar wavelength, surface’s fast recombination of photoelectron–hole pairs and low charge-carrier mobility. Here we report a new stepwise solution synthesis for making a new photocatalytic core/shell of titanate nanowire/reduced graphene oxide shell (or titanate/rGO) 1D-nanocomposite. The new core/shell nanocomposite maximized the specific surface area, largely reduced the charge transfer resistance and reaction energy barrier, and significantly improved the absorption of the visible light. The core/shell nanocomposites’ large on/off current ratio and rapid photo-responses boosted the photocurrent by 30.0%, the photocatalysis rate by 50.0%, and the specific surface area by 16.4%, when comparing with the pure titanate nanowire core. Our numerical simulations support the effective charge separation on the new core-shell nanostructure, which can help further advance the new photocatalysis.

This study aims to explore predictors of the foreign investment from China coming into Rwanda. One of the components of Rwanda’s economy is the investment it receives from other countries. In order to achieve these objectives, the study gathers econometric secondary data from 2007 to 2020 quarterly which were availably provided by National Statistics of China, World Bank, UNCTAD, National Institute of Statistics of Rwanda, and the National bank of Rwanda. From literature and based on the availability of data, market size, trade openness, infrastructure, and human capital were measured as predictors of Chinese FDI. The data is analyzed using linear regression in Stata. The finding of the study showed that variables have a positive effect on FDI from China, and it found that though FDI had an effect on overall economy of Rwanda, the effect was not statistically significant. The study suggested that Rwanda’s policy on foreign investment should aim to attract and encourage Chinese investment to increase the economy of Rwanda. To encourage more FDI, the Rwandan government can offer Chinese investors greater ownership, locational, and internalization benefits. It also should continue to strengthen economic policy transparency since it lowers transaction costs and hence improves incentives for foreign investment.

Few-shot classification is challenging since the goal is to classify unlabeled samples with very few labeled samples provided. It has been shown that cross attention helps generate more discriminative features for few-shot learning. This paper extends the idea and proposes two cross attention modules, namely the cross scaled attention (CSA) and the cross aligned attention (CAA). Specifically, CSA scales different feature maps to make them better matched, and CAA adopts the principal component analysis to further align features from different images. Experiments showed that both CSA and CAA achieve consistent improvements over state-of-the-art methods on four widely used few-shot classification benchmark datasets, miniImageNet, tieredImageNet, CIFAR-FS, and CUB-200-2011, while CSA is slightly faster and CAA achieves higher accuracies.

This paper examines the dynamic dependence structure of crude oil and East Asian stock markets at multiple frequencies using wavelet and copulas. We also investigate risk management implications and diversification benefits of oil-stock portfolios by calculating and comparing risk and tail risk hedging performance. Our results provide strong evidence of time-varying dependence and asymmetric tail dependence between crude oil and East Asian stock markets at different frequencies. The level and fluctuation of their dependencies increase as time scale increases. Furthermore, we find the time-varying hedging benefits differ at investment horizons and reduced over the long run.

The intentional damages to local Cultural Heritage sites carried out in recent months by the Islamic State have received wide coverage from the media worldwide. Earth Observation data provide important information to assess these damages in such non-accessible areas, and automated image processing techniques would be needed to speed up the analysis if a fast response is desired. This paper shows the first results of applying fast and robust change detection techniques to sensitive areas, based on the extraction of textural information and robust differences of brightness values related to pre- and post-disaster satellite images. A map highlighting potentially damaged buildings is derived, which could help experts at timely assessing the damages to the Cultural Heritage sites of interest. Encouraging results are obtained for two archaeological sites in Syria and Iraq.

The algorithmic complexity vulnerability (ACV) that may lead to denial of service attacks greatly disrupts the security and availability of applications, and due to the widespread use of third-party libraries, its impact may be amplified through the software supply chain. The existing work in the field is dedicated to abstract loop or iterative patterns and fuzzing the entire application to discover algorithm complexity vulnerabilities, but they still face efficiency and effectiveness issues. Our research focuses on: (1) Proposing a representation and extraction method for code features related to algorithmic complexity vulnerabilities, helping analysts quickly understand program logic; (2) Providing a new ACV detecting model, focusing on the spatial complexity anomalies caused by deep recursion structures, and proposing a new filtering method; (3) Aiming at the difficulty of efficiently generating complex-data-type-related payloads using existing symbol execution techniques, a call-chain-guided payload construction method is proposed. We tested third-party components in the open-source Java Maven Repository, identified many unexposed vulnerabilities and 8 of them received CVE (Common Vulnerabilities & Exposures) identifiers, and demonstrated that our method can discover more algorithmic complexity vulnerabilities compared to existing tools with better performance.

In view of the problem of charging and hydrogen filling facilities construction in the transition from fuel vehicles to electric vehicles and hydrogen fuel cell vehicles, in order to meet the electric energy demand of electric vehicles and hydrogen energy demand of hydrogen fuel cell vehicles at the same time, this paper puts forward a method of siting and capacity determination of electric-hydrogen refueling integrated station (EHRIS) based on Voronoi diagram and particle swarm algorithm based on calculating the demand of charging and filling of hydrogen in vehicles. Firstly, OD pair(Origin-Destination) is used to represent the starting point and end point of the car to portray the travel demand of the car, and on the basis of the traffic network model, the shortest driving path of the new energy car is determined by Dijkstra algorithm, and Monte Carlo simulation is used to get the electric-hydrogen energy demand of the car; secondly, the Voronoi diagram is introduced to classify the service scope of the electric-hydrogen charging station to determine the equipment capacity of the electric-hydrogen charging station, while taking into account the electric-hydrogen charging and refueling capacity. Secondly, a Voronoi diagram is introduced to divide the service scope of the EHRIS, determine the capacity of the equipment in the EHRIS, and consider the distance constraints between the sites of EHRIS, so as to make the division of the site and service scope more reasonable. Finally, a dynamic optimal current model framework for distribution networks based on second-order cone relaxation is established, and each element of the active distribution network is planned, so that the distribution network can operate safely and stably after being connected to the EHRIS. With the objective of minimizing the total social cost of EHRIS and considering the constraints of the charging equipment and hydrogen production and injection equipment of the EHRIS, a siting and capacity model to meet the electric-hydrogen energy demand of electric and hydrogen fuel cell vehicles is developed, and solved by a particle swarm algorithm. Finally, the simulation planning is carried out with Sioux Falls city and IEEE33 network, which ensures the stable operation of the power grid while meeting the energy demand of automobiles, and the results verify the effectiveness and feasibility of the proposed method.

The methamphetamine epidemic continues to worsen each year and has contributed to more overdose deaths than opioids. Methamphetamine was listed in the top ten lethal drugs in 2021 in the United States. The drug has been shown to cause many health problems. One solution to this crisis is through vaccinations. Although still early in the development phase, vaccinations have been found to improve withdrawal symptoms and decrease drug seeking behavior with minimal health side effects compared to medications.

Microplastics (MPs) are a critical environmental issue, with impacts ranging from ecosystem contamination to health risks through bioaccumulation. This review addresses the inefficacy of traditional water treatments in removing MPs and proposes photodegradation, particularly via nanomaterial-enhanced photocatalysts, as a solution. Utilizing their unique properties like large surface area and tunable bandgap, nanomaterials significantly improve degradation efficiency. Different strategies for photocatalysts modification to improve photocatalytic performance are thoroughly summarized, with the particular emphasis on element doping and heterojunction construction. Furthermore, this review thoroughly summarizes the possible fundamental mechanisms driving photodegradation of microplastics facilitated by nanomaterials, with a focus on processes like free radical formation and singlet oxygen oxidation. By clearly elucidating these strategies and mechanisms, this review aims to provide valuable insights and inspire further progress in microplastic photodegradation.

The implementation of green logistics can reduce the increasingly serious environmental damage and improve the operating efficiency of logistics enterprises. In this paper, through quantitative calculation of logistics negative external costs, including traffic accidents, atmospheric pollution, noise pollution, and pollution caused by packaging, we build accounting standards to calculate the negative external cost of logistics enterprises that mainly generate pollution from transportation and packaging. Then, assuming the impetus provided by government implementing incentive mechanisms in a free market economy, we establish a ‘Logistics Negative External Cost Internalizing’ model, which quantitatively analyzes the relationships among freight rate, freight volume, investment of enterprise for implementing green logistics, and the subsidy given by government, under the comparison of the two modes ‘enterprise operates first’ and ‘government subsidizes first’. The results show that the introduction of ‘government subsidizes first’ incentive mechanism and increasing freight rate are helpful in promoting the process of logistics market greening.

The vibration feature of weak gear fault is often covered in strong background noise, which makes it necessary to establish weak feature enhancement methods. Among the enhancement methods, stochastic resonance (SR) has the unique advantage of transferring noise energy to weak signals and has a great application prospection in weak signal extraction. But the traditional SR potential model cannot form a richer potential structure and may lead to system instability when the noise is too great. To overcome these shortcomings, the article presents a periodic potential underdamping stochastic resonance (PPUSR) method after investigating the potential function and system signal-to-noise ratio (SNR). In addition, system parameters are further optimized by using ant colony algorithm. Through simulation and gear experiments, the effectiveness of the proposed method was verified. We concluded that compared with the traditional underdamped stochastic resonance (TUSR) method, the PPUSR method had a higher recognition degree and better frequency response capability.

This research aims to explore factors that influence sustainable music learning system from psychological perspective, and innovatively constructs a combination of qualitative and quantitative approaches. For first time, combines nonlinear system and identifies relevant factors affecting music learning by establishing data system for questionnaire answering and a quantitative model for actual academic performance. Existing research mainly looks at several factors that affect fragmented music learning system from perspective of teachers' teaching rules, emphasizing phased teaching state and learning goals of teachers as main body, thus ignoring music learning students, who are a large group of music learning objects. The research fills gap in this type of research object, focusing on sustainable music learning system from emotional perspective and students who occupy a dominant position in music learning, so as to more accurately explore impact of their emotional influencing factors on music learning system. The most prominent innovation of this study lies in construction of stochastic nonlinear system for psychological influencing factors of student music learning and a quantitative model for actual learning effect. Through analysis of nonlinear system, weight values of several negative emotions on music learning system are obtained. The comprehensive impact of emotional factors and practical learning on music learning system can be obtained by weighting them together.

For a fiber optic gyroscope, thermal deformation of the fiber coil can introduce additional ther-mal-induced phase errors, commonly referred to as thermal errors. Thermal error compensation techniques are effective means of addressing this issue. The principle behind these techniques involves real-time sensing of thermal errors and correcting them within the output signal. Since it is challenging to directly separate thermal errors from the output signal of the fiber optic gyro-scope, it is necessary to predict thermal errors based on temperature. To establish a mathematical model between temperature and thermal errors, this paper measured synchronized data of phase errors and angular velocity for the fiber coil under different temperature conditions and aimed to model it using data-driven methods. Due to the difficulty of conducting tests and the limited number of data samples, an algorithm called TD-model modeling is proposed to address the issue of overfitting, which can reduce the model's generalization ability. First, a theoretical analysis of the phase errors caused by thermal deformation of the fiber coil is performed. Subsequently, the critical parameters, such as the thermal expansion coefficient, are determined, and a theoretical model is established. Finally, the theoretical analysis model is incorporated as a regularization term and combined with the test data to jointly participate in the regression of model coefficients. Through experimental comparative analysis, it is shown that, relative to ordinary regression models, the TD-model effectively mitigates overfitting caused by the limited number of samples, leading to a 58% improvement in predictive accuracy.

This research aims to explore factors that influence sustainable music learning system from psychological perspective, and innovatively constructs a combination of qualitative and quantitative approaches. For first time, combines nonlinear system and identifies relevant factors affecting music learning by establishing data system for questionnaire answering and a quantitative model for actual academic performance. Existing research mainly looks at several factors that affect fragmented music learning system from perspective of teachers' teaching rules, emphasizing phased teaching state and learning goals of teachers as main body, thus ignoring music learning students, who are a large group of music learning objects. The research fills gap in this type of research object, focusing on sustainable music learning system from emotional perspective and students who occupy a dominant position in music learning, so as to more accurately explore impact of their emotional influencing factors on music learning system. The most prominent innovation of this study lies in construction of stochastic nonlinear system for psychological influencing factors of student music learning and a quantitative model for actual learning effect. Through analysis of nonlinear system, weight values of several negative emotions on music learning system are obtained. The comprehensive impact of emotional factors and practical learning on music learning system can be obtained by weighting them together.

To address the expression pattern of the SARS-CoV-2 receptor ACE2 and the viral priming protease, TMPRSS2, in the respiratory tract, this study investigated RNA sequencing transcriptome profiling of samples of airway and oral mucosa. As shown, ACE2 has medium levels of expression in both small airway epithelium and masticatory mucosa, and high levels of expression in nasal epithelium. The expression of ACE2 is low in mucosal associated invariant T (MAIT) cells, and can’t be detected in alveolar macrophages. TMPRSS2 is highly expressed in small airway epithelium and nasal epithelium, and has lower expression in masticatory mucosa. Our results provide the molecular basis that the nasal mucosa is the most susceptible locus in the respiratory tract for SARS-CoV-2 infection and consequently for subsequent droplet transmission and should be the focus for protection against SARS-CoV-2 infection.

This research analyses extreme precipitation events in the Huaihe River Basin in China, a densely populated region with a history of human settlements and agricultural activities. This study aims to explore the impact of extreme precipitation index changes and provide decision-making suggestions for flood early warning and agricultural development in the Huaihe River Basin. The study utilises the NEX-GDDP-CMIP6 climate models dataset and the daily value dataset (V3.0) from China's national surface weather stations to investigate temporal and spatial changes in extreme precipitation indices from 1960 to 2014 and future projections. At the same time, this study adopted the RclimDex model, Taylor diagram and Sen+Mann-Kendall trend analysis research methods to analyse the data. The results reveal a slight increase in extreme precipitation indices from northwest to southeast within the basin, except for CDD, which shows a decreasing trend. Regarding spatial, the future increase of extreme precipitation in the Huaihe River Basin will show a spatial variation characteristic that decreases from northwest to southeast. These findings suggest that extreme precipitation events are intensifying in the region. Understanding these trends and their implications is vital for adaptation strategy planning and mitigating the risks associated with extreme precipitation events in the Huaihe River Basin.

The Chinese government has expressed great confidence in the role of green finance in fulfilling its carbon neutrality commitment. However, the effectiveness of green finance, especially under the impact of emergencies such as the COVID-19 pandemic scenario, requires further examination. Using data from 2000 to 2020 in China, the correlation between green finance and carbon dioxide (CO2) emissions has been analyzed, both in BaU scenario and the COVID-19 scenario. The following conclusions were drawn: (1) In BaU scenario, green finance can effectively reduce CO2 emissions, especially through government green expenditure and green credit; (2) In COVID-19 scenario, although there is no direct relationship between the pandemic and carbon emissions, the data shows that the pandemic has hindered the progress of green finance, weakened its ability to curb carbon emissions, and indirectly led to an increase in carbon emissions. This study not only clarifies the mechanism by which the COVID-19 pandemic affects carbon emissions through the green finance system but also addresses the common problem of data scarcity in green finance research.

As an effective active remote sensing (ARS) technology for shallow underground targets, ground penetrating radar (GPR) is a detection method to obtain the characteristic information of underground targets by transmitting electromagnetic wave from the antenna and analyzing the propagation law of the electromagnetic wave underground. Due to the high frequency(1MHz-3GHz) of GPR, the depth of geological exploration is shallow(0.1m-30m). In order to remote sensing the deep earth, it is necessary to increase the size of the radiation source in order to reduce the radiation frequency. At the same time, for most separated GPRs, a single dipole antenna (SD) is used as the radiation source and another antenna device placed along the electromagnetic wave propagation direction in the far field as a remote sensing sensor (RSS), both of which are horizontally linearly polarized (LP) antennas. In some cases, such a design is apt to cause problems such as multipath effect (ME) and polarization mismatch (PM). When GPR in ARS of deep earth is performed, it often results in increased errors, signal attenuation during data reception and processing. In contrast, at the radiation source, with the use of large aperture multiple-dipole antennas (MD) and multi-channel sequential rotational excitation, the electromagnetic wave can radiate outward in the form of circular polarization at a low frequency. At the RSS, the trouble caused by ME and PM can be reduced even if the LP antennas are used. A novel sequential rotationally excited (SRE) circularly polarized (CP) MD array for separated GPR in ARS of deep earth is proposed in this paper, which uses a large aperture CP MD array instead of a small size LP SD. The analysis and simulation results demonstrate that under the premise of the same transmitting power, comparing circular polarization and linear polarization, by using SRE CP MD antennas array radiation source, a significant enhancement (about 7dB) of the Signal to Noise Ratio (SNR) will occur by collecting the radiant energy at the RSS. More importantly, by reducing the exploration frequency to 10KHz, the exploration depth will also be greatly increased by about 10 times.

Passive marine listening, involving the acoustic monitoring of underwater environments, has become increasingly vital for scientific research, environmental monitoring, and defense applications. However, the success of such applications critically depends on the ability to extract meaningful information from the often noisy and dynamic underwater acoustic environment. In this context, Mel-frequency cepstral coefficients (MFCCs) have emerged as an essential tool for feature extraction, capturing the spectral characteristics of marine sounds and making them ideal for species identification and sound event detection. This research presents an innovative approach to enhance the robustness of MFCC-based passive marine listening through adaptive noise reduction techniques. The proposed approach utilizes dynamic spectral subtraction to counter underwater noise, resulting in enhanced signal-to-noise ratios for desired sounds. This adaptive system adjusts to dynamic underwater noise, allowing it to concentrate on target sounds and suppress interference effectively. The experimentation further validates the effectiveness of the proposed approach, with results reaching 99% on the full dataset of 570 mammals and vessels, demonstrating the effectiveness of SVM and Random Forests in the classification of underwater audio.

The purpose of this study is to investigate the moderating effect of technology configuration capability on the relationship between strategic flexibility and organizational performance through different stages of technological life cycle. Through the empirical research on the 439 Chinese high-tech organizations, it shows that a technological configuration capability has enhanced the effect of strategic flexibility to the organizational performance in the complex dynamic environment. However, the impact on the different stages of technological life cycle is different. In addition, this paper explored strategic flexibility on different stages of technological life cycle on the basis of empirical study.

(1) Background: China holds the highest esophageal squamous cell carcinoma (ESCC) incidence areas in the world, with some areas of incidence over 100 per 100,000. Despite extensive public health efforts, its etiology is still poorly understood. This study aims to review and summarize past research into potential etiologic factors for ESCC in China. (2) Methods: Relevant observational and intervention studies were systematically extracted from four databases using key terms, reviewed using Rayyan software, and summarized into Excel tables. (3) Results: Among the 207 studies included in this review, 130 studies were focused on genetic etiologic factors, followed by 22 studies focused on dietary-related factors, 18 studies focused on HPV-related factors, and 37 studies focused on other factors. (4) Conclusions: ESCC in China involves a variety of factors including genetic variations, gene-environment interactions, dietary factors like alcohol, tobacco use, pickled vegetables, and salted meat, dietary behavior such as hot food/drink consumption, infections like HPV, poor oral health, gastric atrophy, and socioeconomic factors. Public health measures should prioritize genetic screening for relevant polymorphisms, conduct comprehensive investigations into environmental, dietary, and HPV influences, enhance oral health education, and consider socioeconomic factors overall as integral strategies to reduce ESCC in high-risk areas of China.

Nature-based solutions (NbS) rapidly develop globally to address societal challenges and provide human well-being and biodiversity. Watershed restoration plays an essential role in enhancing the ecological and socio-economic benefits of the region. The design and implementation of watershed restoration projects play a crucial role in their effectiveness, and NbS has been applied as a concept in ecosystem-related projects. This paper provides an idea to evaluate the design or implementation of watershed restoration projects based on the eight criteria proposed by the IUCN Global Standard for Nature-Based Solutions and to adjust the projects based on the evaluation results. The aim is to standardize the implementation process of watershed restoration projects to achieve more significant benefits and practically apply the concept of NbS in watershed restoration. implementation scheme of the Shan-Shui Initiative in the Jiulong River Watershed and concludes that the method is feasible in evaluating and improving the design and implementation scheme of ecological restoration projects in the actual basin. According to the assessment results, the degree of matching based on NbS for the implementation scheme of the Jiulong River Watershed Shan-Shui Initiative is 73%, which meets the criteria of NbS but needs to be improved in terms of monitoring and assessment, synergistic management, and benefit trade-offs.

We consider a coded compressed sensing protocol for unsourced massive random access (URA) that concatenates a shared Patterned Reed-Muller (PRM) inner codebook to an outer error-correction code. In this paper, an iterative list PRM projection algorithm is proposed to supplant the signal detector associated with the inner PRM sequences. In particular, we first propose an enhanced paths-saving algorithm called list PRM projection detection for the single-user scenario that keeps multiple candidates for the first few layers to remedy the risk of spreading errors. On this basis, we further propose an iterative list PRM projection algorithm for the multi-user scenario. The vectors for PRM codes and channel coefficients are jointly detected in an iterative manner, which offers significant improvements regarding the convergence rate for signal recovery. Furthermore, the performances of the proposed algorithms are analyzed mathematically, and we verified that the theoretical simulations are consistent with the numerical simulations. Finally, we concatenate the inner PRM codes that employ the iterative list detection to two practical error-correction outer codes. According to the simulation results, we conclude that the packetized URA with the proposed iterative list projection detection works better than benchmarks in terms of the number of active users it can support in each slot and the amount of energy needed per bit to meet an expected error probability.

By reviewing the research of development economics in recent years, five key terms of ‘innovation, coordination, green, openness and sharing’ are extracted, corresponding to the five dimensions of the New Development Concept advocated by China. Based on this, an evaluation index system of the development quality of China's fishery industry is constructed. The spatio-temporal characteristics of China's fishery industry development quality were analyzed by using the provincial panel data from 2007 to 2017. The results show that: i) China's fishery industry overall development quality continues to grow, while the variation of provincial quality is also increasing, and the contribution of innovation quality and sharing quality is increasing, becoming an important sub-dimension leading the overall development quality.ii) there is a significant spatial dependence among provincial quality, and the significance is further strengthening. The Hangzhou Bay area and Bohai Bay area have gradually become a dual-core area where the high-quality development of China's fishery industry agglomeration, and the radiation from the dual-core area to the peripheral areas may still be in the process of enhancement. The spatial and temporal distribution of China’s fishery industry development quality keeps the trend of ‘from northeast to southwest’, which is almost parallel to Hu Huanyong line. The gravity center of its distribution is close to the gravity center of Chinese population and economy, and the development quality experienced a process from relatively concentrated to dispersed and then returned to concentrated, and the development speed in the later period was higher than that in the earlier period. iii) Capital accumulation level is the dominant positive influencing factors, while government support level is the dominant negative influencing factors respectively, and both have significant spatial differentiation among provinces.

In 2015, the new installed capacity of global renewable energy power generation exceeded the newly installed capacity of conventional energy power generation, marking a structural change in the construction of the global power system. With the continuous improvement of wind energy utilization technology, the global wind power industry has developed rapidly in recent years. The world's available wind energy is 20 billion kilowatts and has become one of the most economical green power. In China, wind power has become the third largest source of electricity, with the installed capacity increasing from 3.1% in 2010 to 9.2% in 2017. In 2017, China's new installed capacity was 19,660 MW, accounting for 37.45% of the world's new installed capacity. This paper evaluates and compares the efficiency of wind power industry in the four regions of eastern, central, western and northeastern China through EBM models based on radial and non-radial factors. This paper discusses the contribution of China's wind power industry to CO2 emission reduction from the relationship between installed capacity efficiency and CO2 emission reduction efficiency. The conclusions show that the overall efficiency score and ranking of wind power in 2013-2017 is the best in the eastern region, followed by the northeast region and the western and central regions.

Recent research efforts in bone tissue engineering have been primarily directed towards manufacture-viable synthesis of biomaterials that can significantly enhance the biocompatibilities and osteogenic capabilities on the new biomaterials. This paper presents a straightforward, cost-effective, optimized, and well-controlled hydrothermal synthesis of Nb-doped potassium titanate nanofibers in high-purity. Characterization data revealed that the Nb-doping potassium titanate maintained the crystal structure, showing great promise for applications in bone tissue engineering.

Due to the extraordinary mechanical properties of ultra-high-performance concrete (UHPC), the shear stirrups in UHPC beams could potentially be removed. The aim of this study is to determine the effect of beam height and steel fiber volume content on the shear behavior of non-stirrup UHPC beams under a larger shear span-depth ratio (up to 2.8). Eight beams were designed and fabricated, including six non-stirrup UHPC beams and two comparing stirrup-reinforced normal concrete (NC) beams. The experimental results demonstrated that the volume content of steel fiber could be a crucial factor affecting the ductility, cracking strength, and shear strength of non-stirrup UHPC beams and altering their failure modes. Additionally, the height of the beam had a considerable effect on its shear resistance. This study revealed that the French standard formulae were more accurate for the UHPC beams with larger shear span-depth ratios and PCI-2021 formulae greatly overestimate the shear capacity of UHPC beams with larger shear span-depth ratios. Xu’s formulae were more accurate for the steel fiber-reinforced UHPC beams with larger shear span-depth ratios.

: As antibiotic resistance undermines efforts to treat bacterial infections, phage therapy is being increasingly considered as an alternative in clinical settings and agriculture. However, a major concern in using phages is that pathogens will develop resistance to the phage. Due to the constant evolutionary pressure by phages, bacteria have evolved numerous mechanisms to block infection. If we determine the most common among them, we could use this knowledge to guide phage therapeutics. Here we compile data from 88 peer-reviewed studies where phage resistance was experimentally observed and linked to a bacterial gene, then assessed these data for patterns. In total, 141 host genes were identified to block infection against one or more of 80 phages (representing five families of the Caudovirales) across 16 microbial host genera. These data suggest that bacterial phage resistance is diverse, but even well-studied systems are understudied, and there are gaping holes in our knowledge of phage resistance across lesser-studied regions of microbial and viral sequence space. Fortunately, scalable approaches are newly available that, if broadly adopted, can provide data to power ecosystem-aware models that will guide harvesting natural variation towards designing effective, broadly applicable phage therapy cocktails as an alternative to antibiotics.

With the development of higher voltage power grid, the high and low voltage parallel loops are emerging, which lead to energy losses, even threaten the security and stability of power system. The multi-infeed HVDC configurations widely appearing in AC/DC interconnected power system make this situation even worse. Aimed at energy saving and system security, a decision optimization method for power grid operating condition with high and low voltage parallel loops is proposed in this paper. Firstly, considering hub substation distribution and power grid structure, parallel loop opening schemes are generated with GN algorithm. Then, candidate opening schemes are preliminarily selected from all these generated schemes based on a filtering index. Finally, with the influence on power system security, stability and operation economy in consideration, an evaluation model for candidate opening schemes is founded based on analytic hierarchy process (AHP). And a fuzzy evaluation algorithm is used to find the optimal scheme. Simulation results of New England 39-bus system and an actual power system validate the effectiveness and superiority of this proposed method.

Based on screening in computational biology and biological in vitro assays, five natural products isolated from extracts of the herbal medicine toad skin, such as cinobufagin (CBFi), bufalin (BFi), arenobufagin (ABFi), telocinobufagin (TBFi), bufotalin (BFTi), were subjected to molecular docking calculations with the use of SARS-CoV-2 main protease (PDB 6LU7 and 7BTF) and top-scoring ligand-receptor complexes were obtained. The results showed that the binding energy of ABFi to the 3CL protein was -17.044kcal/mol, which was higher than CBFi and TBFi. However, the binding energy of ABFi to the RdRp protease was -23.250 kcal/mol, which was much lower than that of CBFi and TBFi, EVEN lower than that of ABFi to the 3CL protein. ABFi also has polar interactions with amino acids such as Glu811, Ser814, Ser681 and Thr680 of RdRp enzyme. The results revealed that ABFi had a moderate inhibitory effect on the cell proliferation of SARS-CoV-2 in vitro, with an inhibition rate of 61.12%, even weaker than Remdesivir. This new discovery provides us with new ideas for in-depth studies on the development of natural products with this class of structural generalizations as inhibitors of SARS-CoV-2, and provides an experimental basis for the next step of mechanistic studies.

Deep underground laboratories offer advantages for conducting high-precision observations of weak geophysical signals, benefitting from a low background noise level. It is both valuable and feasible to enhance strong, noisy ground electromagnetic (EM) field data using synchronously recorded underground EM signals, which typically exhibit a high signal-to-noise ratio. In this study, we propose an EM field reconstruction method employing a Long Short-Term Memory (LSTM) recurrent neural network with referenced deep underground EM observations. Initially, a deep learning model was developed to capture the time-varying features of underground multi-component EM fields using the LSTM recurrent neural network. Subsequently, this model was applied to process synchronously observed strong, noisy data from other conventional observation systems, such as those at surface, to achieve noise suppression through signal reconstructions. Both theoretical analysis and practical observational data suggest that the proposed method effectively suppresses noise and reconstructs clean EM signals. This method is efficient and time-saving, representing an effective approach to fully utilizing the advantages of deep underground observation data. Furthermore, this method could be extended to the processing and analysis of other geophysical data.

This research aims to explore factors that influence sustainable music education from a psychological perspective, and innovatively constructs a combination of qualitative and quantitative approaches. For first time, combines stochastic nonlinear system of control theory and identifies relevant factors affecting sustainable music learning by establishing a data system for questionnaire answering and a quantitative model for actual academic performance. Existing research mainly looks at several factors that affect fragmented music education from perspective of teachers' teaching rules, emphasizing phased teaching state and learning goals of teachers as main body, thus ignoring sustainable music education and students, who are a large group of music learning objects. The research fills gap in this type of research object, focusing on sustainable music education from an emotional perspective and students who occupy a dominant position in music learning, so as to more accurately explore impact of their emotional influencing factors on sustainable music learning. The most prominent innovation of this study lies in construction of stochastic nonlinear system for psychological influencing factors of sustainable student music learning and a quantitative model for actual learning effect. Through analysis of nonlinear system, weight values of several negative emotions on sustainable music learning are obtained.

Using Internet of Things (IoT) applications has been a growing trend in the last few years. They have been deployed in several areas of life including secure and sensitive sectors like military and health. In these sectors, sensory data is the main factor in any decision-making process. This introduces the need to ensure the integrity of data. Secure techniques are needed to detect any data injection attempt before catastrophic effects happen. Sensors have limited computational and power resources. This limitation creates a challenge to design a security mechanism that is both secure and energy-efficient. This work presents a Randomized Watermarking Filtering Scheme (RWFS) for IoT applications that provides en-route filtering to get rid of any injected data at an early stage of the communication. Filtering injected data is based on a watermark that is generated from the original data and embedded directly in random places throughout the packet's payload. The scheme uses homomorphic encryption techniques to conceal the report's measurement from any adversary. The advantage of homomorphic encryption is that it allows the data to be aggregated and, thus, decreases the packet's size. The results of our proposed scheme proved that it improves the security and energy consumption of the system as it mitigates some of the limitations in the existing works.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Translation is spatiotemporally regulated and ER-associated mRNAs are generally in efficient translation. It is unclear whether the ER-associated mRNAs are deadenylated or degraded on the ER surface in situ or in the cytosol. Here, we showed that ER possessed active deadenylases, particularly the poly(A)-specific ribonuclease (PARN), in common cell lines and mouse tissues. Consistently, purified recombinant PARN exhibited a strong ability to insert into the Langmuir monolayer and liposome. ER-anchored PARN was found to be able to reshape the poly(A) length profile of the ER-associated RNAs by suppressing long poly(A) tails without significantly influencing the cytosolic RNAs. The shortening of long poly(A) tails did not affect global translation efficiency, suggesting that the non-specific action of PARN towards long poly(A) tails was beyond the scope of translation regulation on the ER surface. Transcriptome sequencing analysis indicated that the ER-anchored PARN trigged the degradation of a small subset of ER-enriched transcripts. The ER-anchored PARN modulated the translation of its targets by redistributing ribosomes to heavy polysomes, suggesting that PARN may play a role in dynamic ribosome reallocation. During DNA damage response, MK2 phosphorylated PARN-Ser557 to modulate PARN translocation from the ER to cytosol. By promoting the decay of ER-associated MDM2 transcripts with low ribosome occupancy, the ER-anchored PARN modulated DNA damage response and thereby cell viability. These findings revealed that a highly regulated communication between mRNA degradation rate and translation efficiency is present on the ER surface in situ and that PARN may contribute to this communication by modulating the dynamic ribosome reallocation between transcripts with low and high ribosome occupancies.

Stem cells can be used to treat diabetic mellitus and complications. ω3-docosahexaenoic acid (DHA) derived lipid mediators are inflammation-resolving and protective. This study found novel DHA-derived 7S,14R-dihydroxy-4Z,8E,10Z,12E,16Z,19Z-docosahexaenoic acid (7S,14R-diHDHA), a maresin-1 stereoisomer biosynthesized by leukocytes and related enzymes. Moreover, 7S,14R-diHDHA can enhance mesenchymal stem cell (MSC) functions in the amelioration of diabetic mellitus and retinal pericyte loss in diabetic db/db mice. MSCs treated with 7S,14R-diHDHA were delivered into db/db mice i.v. every 5 days for 35 days. Blood glucose levels in diabetic mice were lowered by 7S,14R-diHDHA-treated MSCs compared to control and untreated MSC groups, accompanied by improved glucose tolerance and higher blood insulin levels. 7S,14R-diHDHA-treated MSCs increased insulin+ β-cell ratio and decreased glucogan+ α-cell ratio in islets, as well as reduced macrophages in pancreas. 7S,14R-diHDHA induced MSC functions in promoting MIN6 β-cell viability and insulin secretion. 7S,14R-diHDHA induced MSC paracrine functions by increasing the generation of hepatocyte growth factor and vascular endothelial growth factor. Furthermore, 7S,14R-diHDHA enhanced MSC functions to ameliorate diabetes-caused pericyte loss in diabetic retinopathy by increasing their density in retina in db/db mice. Our findings provide a novel strategy for improving therapy for diabetes and diabetic retinopathy using 7S,14R-diHDHA-primed MSCs.

The adsorption of supramolecular composites for Cs(I) in high level liquid waste (HLLW) are different due to different carriers. We chose 25,27-bis(ethyl)-calix[4]arene-26,28-crown-6 (EC[4]C6) as adsorbent, SiO2-P, XAD-7 and UiO-66 as carriers. The synthesis and characterization of supramolecular EC[4]C6 loaded with three different carriers were presented. SEM, N2 adsorption/desorption isotherms, TG-DSC spectra, FT-IR spectra results shown that EC[4]C6 was successfully introduced into the pores of carriers via physical intermolecular interactions. EC[4]C6/SiO2-P, EC[4]C6/XAD-7 and EC[4]C6/UiO-66 shown high efficiency, high selectivity towards Cs(I) over 18 typical fission or corrosion products in HNO3 solution. The adsorption properties of the three materials were investigated after electron irradiation. These results demonstrate that EC[4]C6/SiO2-P possess greater potential for highly efficient removal of Cs(I) from HLLW.

Solid porous materials, like zeolites, have been widely used in a variety of fields such as size and shape-selective absorption/separation and catalysis because of their porosity. But there are few liquid materials exhibit permanent porosity. Porous liquids are a novel material that combine the properties of fluidity and permanent porosity. It has potential applications in many fields such as gas separation, storage and transport. Herein, we report a novel Type 1 porous liquid prepared based on Silicalite-1. The pore size of this porous liquid was determined by positron annihilation lifetime spectroscopy (PALS), and the CO2 capacities was determined by the intelligent gravimetric analyser (IGA). The unique properties of this porous liquid can promote its application in many fields such as gas storage and transport.

In this paper, PEN3 electronic nose was used to detect and recognize fresh and moldy apples (inoculated with Penicillium expansum and Aspergillusniger) taken Golden Delicious apples as model subject. Firstly, the apples were divided into two groups: apples only inoculated with different molds (Group A) and mixed apples of inoculated apples with fresh apples (Group B). Then the characteristic gas sensors of the PEN3 electronic nose that were most closely correlated with the flavor information of the moldy apples were optimized and determined, which can simplify the analysis process and improve the accuracy of results. Four pattern recognition methods, including linear discriminant analysis (LDA), backpropagation neural network (BPNN), support vector machines (SVM) and radial basis function neural network (RBFNN), were then applied to analyze the data obtained from the characteristic sensors, respectively, aiming at establishing the prediction model of flavor information and fresh/moldy apples. The results showed that only the gas sensors of W1S, W2S, W5S, W1W and W2W in the PEN3 electronic nose exhibited strong signal response to the flavor information, indicating were most closely correlated with the characteristic flavor of apples and thus the data obtained from these characteristic sensors was used for modeling. The results of the four pattern recognition methods showed that BPNN presented the best prediction performance for the training and validation sets for both the Group A and Group B, with prediction accuracies of 96.29% and 90.00% (Group A), 77.70% and 72.00% (Group B), respectively. Therefore, it first demonstrated that PEN3 electronic nose can not only effectively detect and recognize the fresh and moldy apples, but also can distinguish apples inoculated with different molds.

Microplastics pollution in sugarcane areas of China is severe, and reducing their ecological risks is critical. This study aims to explore the effects and mechanisms of microplastics combined with or without biochar on sugarcane growth, soil biochemical properties in red soil by a potted experiment. The results showed that compared with control (CK), microplastic alone treatments reduced the dry biomass of sugarcane, soil pH and the nitrogen (N) and phosphorus (P) contents, obviously decreased the observed_OTUs, Chao1 and Shannon indices of soil total bacteria (16S rRNA gene-based bacteria) while increasing them in phoD-harbouring bacteria. Interestingly, microplastics combined with biochar could alleviate the negative effects of microplastic accumulation on sugarcane growth and soil quality. There were significant differences in the bacterial community compositions among different treatments. Compared with CK, all other treatments significantly decreased the relative abundance of Gemmatimonadota while only microplastic combined with biochar treatments significantly increased the abundance of Subgroup_10 for the 16S rRNA gene, and only microplastic alone treatments significantly increased the relative abundance of Streptomyces for the phoD gene. Moreover, the treatments with microplastics combined with biochar increased the relative abundance of Subgroup_10 and Bradyrhizobium while decreased the IMCC26256 and Streptomyces compared with that in the treatment with microplastics alone. Correlation analysis showed that Subgroup_10 and Bradyrhizobium were significantly positively correlated with sugarcane biomass and several soil properties, while IMCC26256 and Streptomyces were just the opposite. Additionally, different treatments also changed the abundance of potential microbial functional genes. Compared to CK, other treatments increased the abundance of aerobic_ammonia_oxidation, denitrification while decreased the abundance of nitrate_respiration, nitrogen_respiration; meanwhile, these four functional genes involved in N cycling processes were obviously higher in treatments with microplastics combined with biochar than in treatments with microplastic alone. In conclusion, microplastics combined with biochar could alleviate the negative effects of microplastic accumulation on sugarcane growth by improve soil nutrients and microbial community structure and function.

Globally, karst aquifers store large amount of precious water and create beautiful karst springs in many places. However, most of the karst springs flow declined, and some of the karst springs dried up with the effects of extensive groundwater development and climate variation. In order to obtain better understanding of factors contributing to the drying-up of karst springs, this study introduced grey system models to quantify spring flow taking Jinci Springs (China) as an example, which dried up in May 1994. Based on the characteristics of Jinci Springs flow, the spring flow was divided into two stages: the first stage (1954-1960), when the spring flow was affected only by climate variation; and the second stage (1961-1994), when the flow was impacted by both climate variation and anthropogenic activities. Results showed that the Jinci Springs flow had strong relations with precipitation occurring one year and three years earlier in the first stage. Subsequently, a grey system GM (1, 3) model with one-year and three-year lags was set up for the first stage. By using the GM (1, 3) model, we simulated the spring flow in the second stage under effects of climate variation only. Subtracting the observed spring flow from the simulated flow, we obtained the contribution of anthropogenic activities to Jinci Springs cessation. The contribution of anthropogenic activities and climate variation to Jinci Springs cessation was 1.46 m³/s and 0.62 m³/s, respectively. Finally, each human activity causing spring flow decline was estimated. The methods are useful to describe the karst hydrological processes under the effects of anthropogenic activities and climate variation.

The possibility of releasing gold nanoparticles (GNP) into the environment has been rapidly increasing with the wide spread and flourishing application of gold nanoparticles (GNPs) in a wide range of areas. Consequently, environmental effects of GNP, especially toxicities to living organisms have drawn great attention. However, their toxicological characteristics still remain unclear. Fungi, as the decomposers of the ecosystem, interact directly with the environment and critically control the overall health of the biosphere. Thus, their sensitivity to GNP toxicity is particularly important. The aim of this study was to evaluate the role of shape and size of GNPs on their toxicities to fungi, which could help reveal the ecotoxicity of GNPs. Aspergillus niger, Mucor hiemalis and Penicillium chrysogenum were chosen for toxicity assessment, and spherical and star/flower-shaped GNPs sized from 0.7 nm to large aggregates of 400 nm have been synthesised. After exposure to GNPs and their corresponding reaction agents and incubation for 48 hours, the survival rates of each kind of fungus was calculated and compared. The results indicated that fungal species was the major determinant of the variation of survival rates, whereby A. niger was most sensitive and M. himalis was least sensitive to GNP exposure. Additionally, larger and non-spherical GNPs had relatively stronger toxicities.

Preventing the rebound of black and odorous water bodies is critical for improving the ecological environment of water bodies. This study investigated the effect and mechanism of in-situ improvement of sediment microenvironment by nitrate in tailwater of wastewater treatment plants combined with aerobic denitrifying bacteria under low-DO regulation (TailN+CFM+LDO). On the 60th day of remediation, the dissolved oxygen and oxidation-reduction potential in the overlying water increased to 5.6 mg/L and 300 mV, respectively, the acid volatile sulfide in the sediment decreased by 70.4%, and the organic matter in the sediment was reduced by 62.7%, in which the HFOM was degraded from 105 g/kg to 56 g/kg, and the potential risk of water reverting to black and odorous conditions significantly decreased. Amplicon sequencing analysis revealed that the relative abundance of electroactive bacteria Thiobacillus and Pseudomonas with denitrification capacity was found to be significantly higher in the TailN+CFM+LDO group than in the other remediation groups. Functional prediction of 16S sequencing results indicated that both the quantity and activity of critical microbial enzymes involved in nitrification and denitrification processes could enhance in the TailN+CFM+LDO group. These results improved our understanding of the improvement of the sediment microenvironment and could thus facilitate its application.

Evapotranspiration (ET) is an essential part of energy flow between the surface of the earth and the atmosphere, simultaneously involving the water, carbon, and energy cycles. It is mainly determined by climate change, land use, and land cover changes. Climate change is expected to intensify the hydrological cycle and alter ET. Land use affects ET within regional ecosystems mainly through vegetation changes and agricultural activities such as farmland reclamation, crop cultivation, and agricultural management. However, there is still a need for quantitative characterization of the impacts of climate change and human activities on ET and regional water resource efficiency in arid and semiarid regions. Based on Landsat-8 remote sensing imagery and land use data, the planting structure in the Liangzhou District of the middle reaches of the Shiyang River Basin was identified using a multiband and multitemporal approach in this study. Subsequently, the ET of major cash crops was inverted using the three-temperature model. This research quantitatively describes the responses of wheat and corn to the climate and human activities over a two-year period. Furthermore, the impact of planting structure and climatic factors on ET was elucidated. The results indicate that a combination of multitemporal green and shortwave infrared 1 bands is the optimal spectral combination to extract the planting structure. Compared to 2019, the wheat area decreased by 23.27% in 2020, while the corn area increased by 5.96%. Both crops exhibited significant spatial heterogeneity in ET during the growing season. The typical daily range of ET for wheat was 0.4–7.2 mm/day, and for corn, it was 1.5–4.0 mm/day. Among the climatic factors, temperature showed the highest correlation with ET (R = 0.80, p ≤ 0.05). Our research findings provide valuable insights for the fine identification of planting structures and a better understanding of the response of ET to climatic factors and human activities.

The design and fabrication of low-cost catalysts for highly efficient oxygen reduction is of paramount importance for various renewable energy-related technologies, such as fuel cells and metal-air batteries. Herein, we report the in situ growth of Fe3N nanoparticles encapsulated N-doped carbon nanotubes on the surface of flexible biomass-derived carbon cloth (Fe3N@CNTs/CC) via a simple one-step carbonization process. Taking advantage of its unique structure, Fe3N@CNTs/CC was employed as a self-standing electrocatalyst for oxygen reduction reaction (ORR) and possessed high activity as well as excellent long-term stability and methanol resistance in alkaline media. Remarkably, Fe3N@CNT/CC can directly play the role of both gas diffusion layer and electrocatalytic cathode in a zinc-air battery without additional means of catalyst loading, and display higher open circuit voltage, power density, and specific capacity in comparison with the commercial Pt/C catalyst. This work is anticipated to inspire the design of cost-effective, easy-preparation, and high-performance air electrodes for advanced electrochemical applications.

Hierarchical micro-/mesoporous graphitic carbon spheres (HGCS) with a uniform diameter of ~0.35 μm were synthesized by Fe-catalyzed graphitization of amorphous carbon spheres resultant from hydrothermal carbonization. The HGCS resultant from 3 h at 900 °C with 1.0 wt% Fe catalyst had high graphitization degree and surface area as high as 564 m²/g. They also exhibited high specific capacitance of 140 F/g at 0.2 A/g, good electrochemical stability with 94% capacitance retention after consecutive 2500 cycles. The graphitization degree of the HGCS contributed about 60% of their specific capacitance, and their specific capacitance per unit surface area was as high as 0.2 F/m² which was much higher than in the most cases of porous amorphous carbon materials reported before. In addition, the HGCS showed a high adsorption capacity of 182.8 mg/g for methylene blue (MB), which was 12 times as high as that in the case of carbon spheres before graphitization.

Antibiotic resistance is a persistent and growing concern. Our objective was to analyze antibiotic prescribing in the United States (US) in the Medical Expenditure Panel System (MEPS) and to Medicaid patients. We obtained total MEPS prescriptions for eight antibiotics from 2013 to 2020. We extracted prescribing rates per 1,000 Medicaid enrollees for two years, 2018 and 2019, for four broad spectrum (azithromycin, ciprofloxacin, levofloxacin, and moxifloxacin) and four narrow spectrum (amoxicillin, cephalexin, doxycycline, and trimethoprim/sulfamethoxazole) antibiotics. Antibiotics in MEPS decreased from 2013 to 2020 by -38.7% with a larger decline for broad (-53.7%) than narrow (-23.5%) spectrum. Antibiotic prescriptions in Medicaid decreased by -6.7%. Amoxicillin was the predominant antibiotic followed by azithromycin, cephalexin, trimethoprim/sulfamethoxazole, doxycycline, ciprofloxacin, levofloxacin, and moxifloxacin. Substantial geographic variation in antibiotic prescribing existed with 2.8-fold between the highest (Kentucky = 855/1,000) and lowest (Oregon = 299) states. The South prescribed 52.2% more antibiotics (580/1,000) than the West (381/1,000). There were significant correlations across states in antibiotic prescribing. This study identified sizable disparities by geography in prescribing rates of eight antibiotics with over three-fold state level differences. Areas with high antibiotic prescribing rates, particularly for outpatients, may benefit from stewardship programs to reduce potentially unnecessary prescribing.

A challenge in building large-scale superconducting quantum processors is the precise control and manipulation of the qubit state. However, the crosstalk between the microwave control lines impedes the parallel execution of high-fidelity digital and analog quantum operations. Here, we propose and demonstrate a universal compensation protocol for calibrating the microwave signal crosstalk. We also introduce amplified error sequences to optimize the accuracy. Furthermore, we show a definitive improvement in parallel gate operations with crosstalk cancellation, demonstrating the technique's effectiveness. This work paves the way for superconducting hardware that features automated calibration of microwave crosstalk, leading to enhanced fidelities in multiqubit circuits.

The diverse physical appearances and wide density range of polymer bead foams offer immense potential across various applications and future advancements. The multi-scale and multi-level structural features of bead foams involve many fundamental scientific topics. This review presents a comprehensive overview of recent progress in bead foams preparation and molding techniques. Initially, a comparative analysis is conducted among bead foam characteristics of distinct polymers, based on their unique properties. Subsequently, a summary and comparison of molding processes employed for fabricating bead foam parts are provided. Beyond traditional methods like steam-chest molding (SCM) and adhesive-assisted molding (AAM), emerging techniques like in-mold foaming and molding (IMFM) and microwave selective sintering (MSS) are highlighted. Lastly, the bonding mechanisms behind the diverse molding methods are discussed.

The unique characteristics of frescoes on overseas Chinese buildings can attest to the integration and historical background of Chinese and Western cultures. Reasonable analysis and preservation of overseas Chinese frescoes can provide sustainable development for culture and history. This research adopts the image analysis technology based on artificial intelligence, and proposes a ResNet-34 model and method integrating transfer learning. This deep learning model can identify and classify the source of the frescoes of the emigrants, and can effectively deal with the problems such as the small number of fresco images on the emigrants' buildings, poor quality, difficulty in feature extraction, and similar pattern text and style. The experimental results show that the training process of the model proposed in this article is stable. On the constructed Jiangmen and Haikou fresco JHD datasets, the final accuracy is 98.41%, and the recall rate is 98.53%. The above evaluation indicators are superior to classic models such as AlexNet, GoogLeNet, and VGGNet. It can be seen that the model in this article has strong generalization ability and is not prone to overfitting. It can effectively identify and classify the cultural connotations and regions of frescoes.

Breast cancer is one of the most common types of malignant tumors worldwide and the leading cause of cancer-related deaths in women. According to the latest report from the World Health Organization, breast cancer has surpassed lung cancer, becoming the most diagnosed cancer globally. Herein, a systematic, quantitative, and visual analysis of the scientific achievements in natural products research and development for breast cancer over the past 30 years is presented. The study utilizes bibliometric and knowledge graph visualization techniques to analyze the trends, co-occurrence of keywords, cooperative networks, cited literature, and research hotspots in the field. The analysis shows that breast cancer natural drug development involves mutual cooperation between multiple countries, with China, the United States, and India being the most active players. Pharmacology is the discipline with the largest number of articles published in nearly 30 years. The study also reveals that the extraction of drugs from organisms and their metabolites is an important direction in the current development of anticancer drugs. The development of natural medicines for breast cancer together with the mining of genetic knowledge play an important role in treating human breast cancer. The research presented here provides insights into the current state of natural product research and development for breast cancer, and highlights the need for strengthening mutual communication and cooperation between countries and scientific research institutions to enhance the development of breast cancer treatment technologies and natural medicines.