Saliency detection in synthetic aperture radar (SAR) image is a difficult problem. This paper proposed a multitask saliency detection (MSD) model for the saliency detection task of SAR image. Firstly, we extract four features of SAR image as the input of the MSD model, which include the intensity, orientation, uniqueness and global contrast. Then, the saliency map is generated by the multitask sparsity pursuit (MTSP) which integrates the multiple features collaboratively. Subjective and objective evaluation of the MSD model verifies its effectiveness. Based on the saliency maps of the source images, an image fusion method is proposed for the SAR and color optical image fusion. The experimental results of real data show the proposed image fusion method is superior to the presenting methods in terms of several universal quality evaluation indexes, as well as in the visual quality. The salient areas in the SAR image can be highlighted and the spatial and spectral details of color optical image can also be preserved in the fusion result.

In this paper, we establish the generalized Qi-type inequality involving conformable fractional integrals. The results presented here would provide extensions of those given in earlier works.

Marine soft corals are prolific sources of various natural products that have served as a wealthy reservoir of diverse chemical scaffolds for new drug leads. The genus Litophyton contains almost 100 species but only a small part of them had been classified and chemically investigated, which calls for more attentions from the global researchers. In the current work, 109 secondary metabolites have been discussed based on published data from 1975 to July, 2023, covering a period of near five decades. The studied species of the genus Litophyton inhabited various tropical and temperate regions and afforded a variety of biologically active natural products such as terpenes, steroids, alkaloids, and lipids. A wide spectrum of pharmacological effects of these compounds had been evaluated, including cytotoxic, anti-HIV, antibacterial, antifungal, anti-malarial, antifeedant, molluscicidal, PTP1B inhibitory, and insect growth inhibitory activities. This review aims to provide an up-to-date literature survey and comprehensive insight into chemical structures, taxonomical distributions, and biological activities of the reported metabolites from the title genus whenever available.

Modern war is sudden and rapid, and once the battle starts, the demand for equipment maintenance and guarantee will show an outburst situation, which puts equipment maintenance and guarantee capability to a severe test. To accurately grasp the civil-military integration of aviation maintenance and guarantee capabilities, it is necessary to evaluate their capabilities. To this end, the evaluation indicator system is established by using the three-dimensional indicator system construction model of "maintenance task → task demand → capability demand", and the evaluation method based on intuitionistic fuzzy entropy and normal grey cloud model is proposed, using intuitionistic fuzzy entropy theory to determine the expert weights and indicator weights, and the grey cloud model theory to determine the capability evaluation level. Finally, the application process of the evaluation model is demonstrated through specific examples, and the evaluation results are analyzed to verify the effectiveness of the evaluation model.

Modern war is sudden and rapid, and once the battle starts, the demand for equipment maintenance and guarantee will show an outburst situation, which puts equipment maintenance and guarantee capability to a severe test. To accurately grasp the civil-military integration of aviation maintenance and guarantee capabilities, it is necessary to evaluate their capabilities. To this end, the evaluation indicator system is established by using the three-dimensional indicator system construction model of "maintenance task → task demand → capability demand", and the evaluation method based on intuitionistic fuzzy entropy and normal grey cloud model is proposed, using intuitionistic fuzzy entropy theory to determine the expert weights and indicator weights, and the grey cloud model theory to determine the capability evaluation level. Finally, the application process of the evaluation model is demonstrated through specific examples, and the evaluation results are analyzed to verify the effectiveness of the evaluation model.

Contrafreeloading (CFL) refers to animals' tendency to prefer obtaining food through effort rather than free access to food. Researchers have proposed various hypotheses to explain this intriguing phenomenon, but few studies have comprehensively analyzed its influencing factors. In this study, we observed the choice of alternative food containers in budgerigars to investigate their CFL tendencies and the effects of pre-training, food deprivation, and effort required on the CFL levels. The results show that, like most captive animals, budgerigars without food deprivation tend to choose challenging food containers. Additionally, the study finds that pre-trained budgerigars prefer to choose highly challenging food containers, while food-deprived budgerigars tend to choose Easy food containers. Moreover, budgerigars showed more selection time proportion on moderate challenging than high challenging food containers. In conclusion, budgerigars exhibit CFL tendencies, and pre-training enhances their CFL levels, while high challenge and deprivation of food decrease their contrafreeloading level. Studying animal contrafreeloading can help understand why animals choose to expend effort to obtain food rather than accessing it for free, and it also has implications for setting feeding environments to enhance the animal welfare of captive and domesticated animals.

In the paper, by virtue of a Lévy–Khintchine representation and an alternative integral representation for the weighted geometric mean, the authors establish a Lévy–Khintchine representation and an alternative integral representation for the Toader–Qi mean. Moreover, the authors also collect an probabilistic interpretation and applications in engineering of the Toader–Qi mean.

Abstract Background: Parkinson's disease (PD) is a neurodegenerative disorder featured with motor and non-motor deficits. Using 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP) induced dopamine neuron degeneration has been widely used to produce reliable animal models of the PD. However, most of previous preclinical studies focused on the motor dysfunctions, few non-motor symptoms were evaluated. So far there is a lack of comprehensive investigation of the non-motor symptoms in animal models. Objectives: In this study, we aim to use a battery of behavioral methods to evaluate the non-motor symptoms in MPTP-induced non-human primate PD models. Methods: Cognitive functions, sleep and psychiatric behaviors were evaluated in MPTP-treated cynomolgus monkeys. The tests consisted of delayed matching-to-sample (DMTS), physical activity monitor (PAM), apathy feeding task (AFT), human intruder test (HIT), novel fruit test (NFT) and predator confrontation test (PCT). In addition, we tested whether the dopamine receptor agonist pramipexole (PPX) will improve these non-motor symptoms. Results: The present results show that the MPTP-treated monkeys exhibited cognitive deficits, abnormal sleep, and anxiety-like behaviors as compared to the control monkeys. These symptoms were relieved partially by PPX. Conclusions: These results suggest that MPTP-induced PD monkeys displayed non-motor symptoms that were similar to those found in PD patients. PPX treatment showed moderate therapeutic effects on these non-motor symptoms. This battery of behavioral tests may provide a valuable model for future preclinical research.

Semi-continuous data are very common in the social science and economics. In this paper, a Bayesian variable selection procedure is developed to assess the influence of exogenous factors including observed and unobserved on the semi-continuous data. Our formulation is based on the two-part latent variable model with polytomous response. We consider two schemes for the penalties of regression coefficients and factor loadings: the Bayesian spike and slab bimodal prior and the Bayesian lasso prior. Within the Bayesian framework, we implement Markov Chains Monte Carlo sampling method to conduct posterior inference. To facilitate posterior sampling, we recast the logistic model in part one as the norm-like mixture model. Gibbs sampler is designed to draw observations from the posterior. Our empirical results show that with suitable hyper-parameters, the spike and slab bimodal method slightly outperforms the Bayesian lasso in the current analysis. Finally, a real example related to the China household finance survey is analyzed to illustrate the application of the methodology.. .

Expansion tube is ideal energy absorber which dissipates kinetic energy through plastic deformation and friction. There is an urgent need to understand the influence of key parameter, e.g. semi angle, tube material, and friction coefficient, on the mechanical response and energy absorption characteristics of expansion tube. In the present work, the material properties of the tubes were tested under quasi-static loading condition, and the numerical simulations were carried out by using commercial software ABAQUS. Based on the validated finite element simulation, all the semi angle, tube material, and friction have significant effects on the energy absorption capacity of expansion tube. The expansion tube with high tensile stress of parent material have high energy absorption capacity, while the specific energy absorption is linear with the tensile stress/density of tube material. This work would give a guidance to the structural design and parent materials selection for expansion tubes.

In order to explore the effects of glutamate on the growth performance, antioxidant capacity and protein metabolism of juvenile Chinese mitten crab. 0%, 1% and 2% glutamate were supplemented to low protein (30%) and normal protein (35%) diets respectively. There were 5 parallel tanks in each treatment, and the feeding duration was 8 weeks. The results showed that dietary glutamate did not significantly affect the weight gain of Chinese mitten crab. Diets supplemented with 2% glutamate significantly decreased the crude protein of crabs. The T-AOC of crabs fed the 30% protein diets was significantly lower than crabs fed the 35% protein diets. At 30% protein level, the superoxide dismutase (SOD) activity significantly increased with the increase of glutamate content. Dietary glutamate significantly down-regulated the relative expressions of mTOR, PI3K, S6K1 and 4EBP at 35% protein level. In conclusion, dietary glutamate cannot significantly increase the growth of Chinese mitten crab, but it can improve the antioxidant capacity in Chinese mitten crab under low protein condition.

In order to study the effects of soybean isoflavones on the growth performance and lipid metabolism of juvenile Chinese mitten crab, six experimental diets were formulated by gradient supplementation 0%, 0.004% and 0.008% soybean isoflavones at different dietary lipid levels (10% and 15%), which were named to NF-0 group (10% fat and 0% SIF), NF-0.004 group (10% fat and 0.004% SIF), NF-0.008 group (10% fat and 0.008% SIF), HF-0 group (15% fat and 0% SIF), HF-0.004 group (15% fat and 0.004% SIF) and HF-0.008 group (15% fat and 0.008% SIF). All crabs with an initial weight of 0.4 ± 0.03 g were fed for 8 weeks. The results showed that diets supplementation with 0.004% or 0.008% SIF significantly increased the weight gain and specific growth rate of crabs. Diets supplementation with 0.004% or 0.008% SIF significantly reduced the content of non-esterified free fatty acids and triglycerides in the hepatopancreas of crabs at 10% dietary lipid level. Dietary SIF significantly decreased the relative mRNA expressions of elongase of very long-chain fatty acids 6 (elovl6), triglyceride lipase (tgl), sterol regulatory element binding protein 1 (srebp-1), carnitine palmitoyltransferase-1a (cpt-1a), fatty acid transporter protein 4 (fatp4), carnitine palmitoyltransferase-2 (cpt-2), Δ9 fatty acyl desaturase (Δ9 fad), carnitine palmitoyltransferase-1b (cpt-1b), fatty acid binding protein 10 (fabp10) and microsomal triglyceride transfer protein (mttp) in the hepatopancreas of crabs. At 15% dietary lipid level, 0.008% SIF significantly increased the relative mRNA expressions of fatty acid binding protein 3 (fabp3), carnitine acetyltransferase (caat), fatp4, fabp10, tgl, cpt-1a, cpt-1b and cpt-2 and significantly down regulated the relative mRNA expressions of Δ9 fad and srebp-1. In conclusion, SIF can improve the growth and utilization of high-fat diet by inhibiting genes related to lipid synthesis and promoting lipid decomposition in juvenile Chinese mitten crab.

Pluripotent stem cells (PSCs) can differentiate into three germ layers and diverse autolo-gous cell lines. Being among the most commonly used large domesticated hoofed animals and serving as a vital source of food and bioreactors, cattle are among the many species in which PSCs have been developed. Bovine PSCs (bPSCs) are the "seed cells" of regenerative science and have immense potential to advance species propagation, genetic engineering, and disease treatment. Moreover, they can aid in screening new drugs for efficacy and toxicity, model human diseases, and establish a sustainable agricultural system that can cater to the needs of the growing global population. Establishing stable bPSCs in vitro has been a critical scientific challenge, and researchers have made numerous attempts to address this issue. This review primarily delves into the current research progress of bPSCs, the challenges faced, and their potential applications.

The insufficient of fish meal has been become a prominent problem with the development of the aquaculture industry. Therefore, it is great significance that replacement fish meal using other protein sources for the sustainable development of aquaculture industry. In this study, fermented cottonseed meal (FCM) and fermented rapeseed meal (FRM) were used to replace fish meal in Chinese mitten crab. The ratio of FCM and FRM were set according to 1:2, 1:1, and 2:1, and were supplemented into 25% fish meal (FM-25) and 15% fish meal (FM-15) diets, respectively, to formulated 6 kinds of experimental diets. The feeding duration was 8 weeks. The results showed that the weight gain (WG) and specific growth rate (SGR) of crabs fed the diets containing 25% fish meal were significantly higher than crabs fed 15% fish meal diets. At 25% fish meal level, the WG and SGR of crabs fed the diet with 1FCM:1FRM were significantly higher than those fed the 1FCM:2FRM and 2FCM:1FRM diets. At 25% fish meal level, the crude lipid (CL) content of crabs fed the diet with 1FCM:2FRM were significantly higher than those fed the 2FCM:1FRM and 1FCM:1FRM. At 25% fish meal level, the activities of glutathione peroxidase (GPX) and peroxidase (POD) of crabs fed the diet with 1FCM:2FRM were significantly higher than those fed the 2FCM:1FRM and 1FCM:1FRM. At 25% fish meal level, the relative expression of peroxiredoxin (PRX) of crabs fed the diet with 1FCM:1FRM were significantly higher than those fed the 2FCM:1FRM and 1FCM:2FRM. In summary, diets supplemented with a mixture of fermented cotton meal and fermented rapeseed meal (1:1) can significantly improve the growth and antioxidant capacity of Chinese mitten crab.

Structurally clear compounds have advantages for quality control in plant biostimulant production and application processes. Humic acid (HA) is a biostimulant that significantly affects plant growth, and soil-dwelling Protaetia brevitarsis larva (PBL) can rapidly convert agricultural waste into HA. In this study, we use PBL as a model to investigate HA formation and screen for HA-related structurally clear plant biostimulant compounds. The dephasing magic angle spinning nuclear magnetic resonance (13C DD–MAS NMR) analysis indicated HA structural changes during PBL digestion; the metabolic profile detected seven HA-related aromatic ring-containing compounds. Plant experiments identified six compounds with stimulating effects, with piperic acid being reported for the first time in this study. Thus, this study not only provides insights into the insect-mediated transformation of HA but also illustrates a new strategy for discovering structurally clear plant biostimulant compounds.

Desert ecosystem occupies an important position in the composition of global biodiversity. The Tarim Basin locates in south Xinjiang of China and has the world 's second largest mobile desert, the Taklamakan Desert. As an endemic species in this region, Phrynocephalus forsythii has been demonstrated with potential high extinction risk to climate change. In order to understand the overall genetic status and provide accordant conservation strategies of the species, we investi-gated the genetic diversity and population structure of P. forsythii from 15 sites in the Tarim Basin using 21 highly polymorphic microsatellite markers. We found significant genetic structure across the study region. We also revealed generally low levels of gene flow between the 25 sites, sug-gesting individual dispersal and migration may be restricted within populations. In addition, geographical distance and ambient temperature might be important factors in explaining the observed genetic structure. Our results will provide scientific basis for the future protection of P. forsythii in this area, as well as an important reference for the conservation and management of biodiversity in desert ecosystems.

The energy E takes the place of the gravitational mass m_G to produce gravity [1]. We wonder whether the inertial mass m_i in the inertial force is also replaced by E. The experiments to measure the inertial force and weight of a carrier are presented. Now we can test the principle of equivalence and study foundations of physics in condensed matter.

Lignin is insoluble in water, limiting its use in the synthesis of adhesives. Therefore, in order to increase the amount of lignin raw materials used in the synthesis of adhesives, a kind of aminated lignin compounds was prepared through lignin amination reaction, and conducting structural analysis in this paper. The particle size of the amino lignin is about 100 nm, with the weight average molecular weight of 57,627 g/mol and a water solubility of 0.45g/100ml. The reaction mechanisms were proposed that the phenolic hydroxyl groups of lignin react with ammonia molecules, and thereby successfully introducing amino groups to generate the aminated lignin compounds. Therefore, this article enriches the scientific theory of lignin reactions and provides reference for the widespread application of lignin raw materials in the field of adhesives.

In the paper, the author introduces the notions "multi-order logarithmic numbers" and "multi-order logarithmic polynomials", establishes an explicit formula, an identity, and two recurrence relations by virtue of the Faa di Bruno formula and two identities of the Bell polynomials of the second kind in terms of the Stirling numbers of the fi rst and second kinds, and constructs some determinantal inequalities, product inequalities, logarithmic convexity for multi-order logarithmic numbers and polynomials by virtue of some properties of completely monotonic functions.

Over the past decades, overweight and obesity has become a global epidemic and the leading threat for death. To prevent the serious risk, an overweight or obese individual must apply a long-term weight-management strategy to control food intake and physical activities, which is however, not easy. Recently, with the advances of information technology, more and more people can use wearable devices and smartphones to obtain physical activity information, while they can also access various health-related information from Internet online social networks (OSNs). Nevertheless, there is a lack of an integrated approach that can combine these two methods in an efficient way. In this paper, we address this issue and propose a novel mobile-social framework for health recognition and recommendation, namely, H-Rec². The main ideas of H-Rec² include (1) to recognize the individual's health status using smartphone as a general platform, and (2) to recommend physical activity and food intake based on personal health information, life science principles, and health-related information obtained from OSNs. To demonstrate the potentials of the H-Rec² framework, we develop a prototype that consists of four important components: (1) an activity recognition module that senses physical activity using accelerometer, (2) a health status modeling module that applies a novel algorithm to generate personalized health status index, (3) a restaurant information collection module that collects relevant information from OSN, and (4) a restaurant recommendation module that provides personalized and context-aware recommendation. To evaluate the prototype, we conduct both objective and subjective experiments, which confirm the performance and effectiveness of the proposed system.

After the end of colonial rule in 1997, the Hong Kong education system has been experiencing a policy reform on Senior Secondary Education (NSS) Curriculum commenced in September 2009 aiming to educate students as globalized Hong Kong citizens for the Western. Although previous scholars argued that it is hard to differentiate between domestic values and the Western values in account of curriculum development (Sewpaul, 2007), this study demonstrates an analysis using the dichotomy to investigate how local curriculum, especially in the post-colonial areas, embrace both the Western values and domestic values. Using content analysis on the NSS curriculum guides, this article evaluates the influence of the Western values and Chinese values in the NSS curriculum through investigating: (1) how the Western values and Chinese values was incorporated into the curriculum throughout its development (2) why some values are more significantly highlighted in the curriculum guide. Findings include that more Chinese values are involved in the curriculum documents. This may be because of the upholding of domestic values as a post-colonial city. The Western values which are academically related are greatly incorporated into the local curriculum.

Background: Constipation is one of the chronic gastrointestinal functional diseases that affects the quality of life. While Qi Lang Formula (QLF) has demonstrated effectiveness in alleviating constipation symptoms, its precise mechanism remains elusive. Methods: QLF was analyzed using UPLC-MS/MS. Targets for QLF were collected from SwissADME, Herb, ITCM databases, and FC-related targets from scRNA-seq and Genecards databases. Overlapping targets suggested potential QLF therapy targets for FC. Enrichment analysis used the KOBAS database. A "drug-ingredient-target" network was constructed with Cytoscape, and AutoDock verified active component binding. H&E staining assessed colonic mucosa changes, TEM examined ICC structural changes. ELISA measured neurotransmitter levels, and western blot verified QLF's effect on target proteins. ICC proliferation was observed through immunofluorescence. Results: We identified 89 targets of QLF associated with ICC-related FC, with c-Kit emerging as the pivotal target. Molecular docking studies revealed that Atractylenolide Ⅲ, Apigenin, Formononetin, Isorhamnetin, Naringenin, and Ononin exhibited strong binding affinities for the c-Kit structural domain. QLF significantly enhanced first stool passage time, fecal frequency, fecal moisture content, and intestinal propulsion rate. Further analysis unveiled that QLF not only restored neurotransmitter levels but also mitigated colon muscular fiber ruptures. ICC ultrastructure exhibited partial recovery, while RT-qPCR and western blot confirmed upregulated c-Kit expression and downstream targets. Immunofluorescence results indicated ICC proliferation post QLF treatment in rat colon. Conclusion: Our findings suggest that QLF may promote ICC proliferation by targeting SCF/c-Kit and its downstream signaling pathway, thereby regulating intestinal motility.

In the paper, the author finds bounds of the sine and cosine along a circle on the complex plane in terms of two double inequalities for the norms of the sine and cosine along a circle on the complex plane.

Currently the rapid growth of global economy has the competition among high-tech industries develop from regional to global, and the competition becomes fierce. In face of such fierce competition in global high-tech industry, it is realized that tangible assets could no longer be the differentiation basis, but intangible assets are regarded as the differentiation capital. An enterprise with sustainable innovation would dominate the world market and enhance the international competitiveness of domestic economy. When internal entrepreneurial culture is prevalent, an enterprise would naturally promote the innovation capability. Such a point of view also explains more popular of the innovative products or services of some enterprises than those with larger scales. Aiming at employees in high-tech industry in Guanxi Province, total 500 copies of questionnaire are randomly distributed, and 337 valid copies are retrieved, with the retrieval rate 67%. The research results reveal significantly positive correlations between 1.entrepreneurial culture and sustainable innovation capability, 2.sustainable innovation capability and patent, and 3.entrepreneurial culture and patent. According to the results, suggestions are proposed, expecting to explain how a high-tech business outperforms in the changeable digital era and acquires the sustainable innovation capability and patent to grasp the opportunity.

In the paper, the author discusses and computes bounds of the sine and cosine along straight lines on the complex plane.

This paper studies the integrated design problems of control and guidance with parameter uncertainties, target disturbances, input constraints and actuator faults. Firstly, based on the integrated design idea of the missile guidance and control, the auxiliary variable is used to establish and transform it into a cascade system with input constraints, actuator faults and disturbances of unknown upper bounds. Secondly, the adaptive anti-saturation dynamic surface fault-tolerant controller is designed by using the back-stepping method, adaptive control, auxiliary system and tracking differentiator. By introducing the tracking differentiator and tangent barrier Lyapunov function, the computational explosion problem in the traditional back-stepping method is avoided and the angle of attack can be guaranteed in prospective range, respectively. Finally, the theoretical proof of the designed control strategy is given to ensure that the states of the closed-loop system are bounded. At the same time, the digital simulation of the maneuvering target of different maneuvering forms is carried out, which further illustrate the effectiveness and robustness of the designed control schemes.

The limited understanding of how digital platforms, especially the Metaverse, influence public perception and attitude towards sustainable fashion in large scaled markets such as China highlights a critical gap. This study aims to examine the perspectives and perception of the Chinese public regarding sustainable fashion in the Metaverse. Through content analysis, this study evaluated 3,889 Weibo posts from Shanghai Fashion Week 2024 to identify key sentiments and discussions on sustainable and digital fashion. Results indicate that 76.08% of the conversations centered on sustainable fashion, reflecting strong public commitment to environmental issues. The findings highlight characteristics of public perception towards the utilization of immersive technologies and underscore the Metaverse's potential as a platform for fostering environmental consciousness in the fashion industry. This research provides crucial insights for fashion brands looking to integrate sustainability into their digital strategies, addressing a significant gap in current literature and offering practical guidance for leveraging digital platforms to promote sustainable consumption.

In the paper, by convolution theorem for the Laplace transforms and analytic techniques, the author finds necessary and sufficient conditions for complete monotonicity, monotonicity, and inequalities of several functions involving polygamma functions. By these results, the author derives a lower bound of a function related to the sectional curvature of the manifold of the beta distributions. Finally, the author poses several guesses and open problems related to monotonicity, complete monotonicity, and inequalities of several functions involving polygamma functions.

This paper describes the formulations for viscoplasticity of metals based on the Chaboche and Delobelle model. The implementations of the viscoplastic models were detailed herein and then implemented via user subroutines for material models (UMAT) in ABAQUS. Two typical metals, i.e., 316 Stainless Steel and Zircaloy-4, were chosen as examples and their viscoplastic behaviors were captured. Numerical simulations are compared to reported experiments to validate the models and the UMAT codes. Typical viscoplastic behaviors of both metals, such as stress relaxation and creep, were captured well against available experiments. We publicize all the data and codes via: https://github.com/XJTU-Zhou-group/ABAQUS_UMAT_316ss_Zr4.

This paper considers the Hermitian solutions of a new system of commutative quaternion matrix equations, we establish both necessary and sufficient conditions for the existence of solutions. Furthermore, we derive an explicit general expression when it is solvable. To illustrate our main findings, we present two numerical algorithms and examples in this paper.

Face verification for unrestricted faces in the wild is a challenging task. This paper proposes a method based on two deep convolutional neural networks(CNN) for face verification. In this work, we explore to use identification signal to supervise one CNN and the combination of semi-verification and identification to train the other one. In order to estimate semi-verification loss at a low computation cost, a circle, which is composed of all faces, is used for selecting face pairs from pairwise samples. In the process of face normalization, we propose to use different landmarks of faces to solve the problems caused by poses. And the final face representation is formed by the concatenating feature of each deep CNN after PCA reduction. What's more, each feature is a combination of multi-scale representations through making use of auxiliary classifiers. For the final verification, we only adopt the face representation of one region and one resolution of a face jointing Joint Bayesian classifier. Experiments show that our method can extract effective face representation with a small training dataset and our algorithm achieves 99.71% verification accuracy on LFW dataset.

The gravitational charge should be the energy instead of mass. This modification will lead to some different results and the experiments to test are also presented. Especially, we propose a scheme to achieve the negative energy and gravitational repulsive force in the lab.

Spermatogonial stem cells (SSCs) are the only primitive spermatogonial cells in males that can naturally transmit genetic information to their offspring and replicate throughout their lives. Phospholipase D family member 6 (PLD6) has recently been found to be a surface marker for SSCs in mice and boars; however, it has not been validated in cattle. The results of RT-PCR and qRT-PCR found that the relative expression of PLD6 gene in the testicular tissues of 2-year-old Simmental calves was significantly higher than that of 6-month-old calves. Immunofluorescent staining further verified the expression of PLD6 protein in bovine spermatogenic cells like germ cell marker VASA. Based on multiple bioinformatic databases, PLD6 is a conservative protein which has high homology with mouse Q5SWZ9 protein. It is closely involved in the normal functioning of the reproductive system. Molecular dynamics simulation analyzed the binding of PLD6 as a phospholipase to cardiolipin (CL), and PLD6-CL complex showed high stability. The protein interaction network analysis showed that there is a significant relationship between PLD6 and piRNA binding protein. PLD6 acts as an endonuclease and participates in piRNA production. In addition, PLD6 in bovine and mouse testes has a similar expression pattern with the spermatogonium-related genes VASA and PIWIL2. In conclusion, these analyses imply that PLD6 has a relatively high expression in bovine testes and could be used as a biomarker for spermatogenic cells including SSCs.

Predicting and evaluating the vitality level of public spaces of urban design is crucial before new construction and renewal, especially for developing countries, to avoid failures like "ghost neighborhood" and reduce resource waste. However, existing assessment methods for the urban vitality are either static and ignore changes in the time dimension, or rely on historical big data and are unable to predict unbuilt projects. This study combines previous methods and crowds’ characteristics observation in public space, puts forward the crowd-frequency hypothesis and constructs an algorithm, and establishes a time-dimensional urban vitality dynamic prediction model. Taking the Rundle Mall neighborhood in Adelaide, Australia, as an example, the effec-tiveness of the prediction model was proved through on-site observation sampling comparative verification method. In addition, the decision tree model was used to conduct machine learning on the case data, and a set of algorithm programs were obtained that can directly input some basic information to obtain the urban vitality level (high-medium-low) in a certain period. It can be used as a tool to support the design and decision-making processes of urban planners and government officials, providing a low-cost way to achieve sustainable urban vitality construction of late-developing cities directly.

The quantified residence time distribution (RTD) provides a numerical characterization of mixing in the continue casting tundish, thus allowing the engineer to better understand the metallurgical performance of the reactor. This paper describes a computational fluid dynamic (CFD) modelling study for analyzing the flow pattern and the residence time distribution in a five-strand tundish. Two passive scalar transport equations are applied to separately calculate the E-curve and F-curve in the tundish. The numerical modelling results are compared to the water modelling results for the validation of the mathematical model. The volume fraction of different flow regions (plug, mixed and dead) and the intermixing time during the ladle changeover are calculated to study the effects of the flow control device (FCD) on the tundish performance. The result shows that a combination of the U-baffle with deflector holes and the turbulence inhibitor has three major effects on the flow characteristics in the tundish: i) reduce the extent of the dead volume; ii) evenly distribute the liquid streams to each strand and iii) shorten the intermixing time during the ladle changeover operation.

Given the increased provision of international exchange programmes in higher education, this paper examines students’ perceptions of their learning process in one Erasmus+ programme in Food Innovation and Product Design. Using evaluation model of international exchange programme and triple helix model as the analytical framework, students’ testimonials from 2015–2021 were analysed using a critical discourse analysis. EU and non-EU students had similar perceptions of learning outcomes related to knowledge of the food innovation industry, but non-EU students had a stronger sense of awareness of both the international context and multicultural interaction.

Abstract: Steamed ginseng water (SGW), the by-product generated from the heated processing of red ginseng, with high content of active substances, better skincare activities, and large amount output ineffective utilization, resulted in environmental pollution and resource waste. In current study, UHPLC-Q-Exactive-MS/MS liquid chromatography-mass spectrometry and multivariate statistical analysis were conducted to characterize the compositional features of the repeated thermal-treated SGW. The total sugar content, total sugar content, total reducing sugar content, total non-reducing sugar content, DPPH, ABTS+, Fe3+ reducing capacity, and the hydroxyl radical scavenging abilities were employed to evaluate the gross contents variation connect with anti-oxidant activities during heat processes. The result revealed the SGW content and antioxidant activity were highly correlated, the 7th SGW sample showed the highest content and the strongest ability on anti-aging capacities. 38 significant common differential markers were screened, by the four compared SGW groups (1- and 3-, 1- and 5-, 1- and 7-, and 1- and 9) through OPLS-DA analysis. The current study showed that the thermal proceeding times could be a vital index value during the recycling operation quality control of SGW, which has a huge potential in anti-aging cosmetic raw materials, In the meanwhile, our results provided a green, sustainable, low-cost thinking of rational application on ginseng resource.

In the paper, the authors survey integral representations (including the Lévy--Khintchine representations) and applications of some bivariate means (including the logarithmic mean, the identric mean, Stolarsky's mean, the harmonic mean, the (weighted) geometric means and their reciprocals, and the Toader--Qi mean) and the multivariate (weighted) geometric means and their reciprocals, derive integral representations of bivariate complex geometric mean and its reciprocal, and apply these newly-derived integral representations to establish integral representations of Heronian mean of power 2 and its reciprocal.

Fire is a common natural disturbance in forest ecosystems and plays an important role in subsequent vegetation patterns. Based on the spatial sequence method instead of the time successional sequence method, this study selected burned areas in different locations in the Anning River Basin, which contains typical dry valleys. Quadrat surveys and quantitative classification were used to identify the vegetation classification, distribution pattern, and environmental interpretation during the natural restoration process after forest fire. The results showed that: (1) the vegetation community in the early stage of natural recovery after forest fire disturbance could be divided into seven community types, and Quercus guyavaefolia H. Leveille (Qg) was the dominant species in the community; (2) vegetation samples could be divided into five ecological types, and the classification and distribution pattern of community types in this region changed most obviously with altitude; and (3) detrended correspondence analysis could clearly classify vegetation community types, and detrended canonical correspondence analysis could well reveal the relationships between species and environmental factors. This study provides a scientific basis guiding the restoration of ecosystem structural stability and biodiversity in burned areas.

Photoacoustic imaging (PAI) is a cutting-edge biomedical imaging modality, providing detailed anatomical and functional information about the area beneath the skin surface. Its light energy deposition is such that PAI typically provides clear images of the skin with high signal-to-noise ratios. Specifically, the rich optical contrast of PAI allows biological information related to lesion growth, malignancy, treatment response, and prognosis to be seen. Given its significant advantages and emerging role in imaging skin lesions, we summarize and comment on representative studies of skin PAI, such as the guidance of skin cancer biopsies and surgical excisions, and the accurate diagnosis of psoriasis. We conclude with our insights about the clinical significance of skin PAI, showing how its use to identify biological characteristics in lesion microenvironments allows early diagnosis and prognosis of disease.

In recent years, many algorithms based on end-to-end deep networks have been proposed to deal with the target detection problem of videos. However, the deep network models usually consume a lot of computing resources during the procedure of analysis of videos with complex dynamic backgrounds. In this paper, a new method of object detection based on information theory is presented. Firstly, each frame in a video is converted into an effective information map by using the Harris corner detection method. Secondly, the sensitive areas in the frame are extracted by using the context information and the effective information maps of the consecutive video frames. The sensitive areas in the video frame are the candidate areas where the target objects would be appeared at high probabilities. Thirdly, the information entropy features of each sensitive area are extracted to form the feature matrix, based on which, an SVM model is trained for selecting the target areas from the sensitive areas. Finally, the locations of the objects are detected based on the target areas in the video with a complex dynamic background. As a lightweight video detection framework, the method presented in this paper can save a lot of computing resources. Experimental results show that this method can achieve good results in the benchmark of CDnet 2014.

The main purpose of this paper is to present a comprehensive view of the application mathematical models in the designing and implementing SSCM beside to solving problems and making decision. The research questions are: what mathematical models are used for designing and implementing sustainable supply chain management, how to use them, which industries implemented in, what modules of SSCM depth in and finally finding the gaps of researches. The methodology of research is Systematic Literature review through peer review papers which are published in high ranking journals. In this paper, First, we search all papers through scientific data bases like Scopus, science direct, MDPI, Springer, Google Scholar, then, screening papers based on the criteria such as subject of paper, journals impact factor which is published in-should be peer review journal- and relative content of the papers. Finally, we selected 245 papers with three steps screening through 2806 papers that they have enough quality and relative to our research goals for context analysis. Through context analysis, first we categorized the information of the papers and drew the current situation of researches in the framework of our topic. Then, we evaluate and compare the goals of sustainability and current situation and found the gapes, then, offered new suggestions like implementing SSCMs models in pollutant industries like casting industry, Heavy industry, coal Industry and so on. On the other hand, there are gaps in researches in some modules of SSCM such as packaging, designing products, etc.

In the paper, the authors survey integral representations of the Catalan numbers and the Catalan–Qi function, discuss equivalent relations between these integral representations, supply alternative and new proofs of several integral representations, collect applications of some integral representations, and present sums of several power series whose coefficients involve the Catalan numbers.

In the paper, by virtue of convolution theorem for the Laplace transforms, Bernstein's theorem for completely monotonic functions, and other techniques, the author finds necessary and sufficient conditions for a difference constituted by four derivatives of a function involving trigamma function to be completely monotonic.

In the paper, by induction and recursively, the author proves that the generating function of multivariate logarithmic polynomials and its reciprocal are a Bernstein function and a completely monotonic function respectively, establishes a Lévy-Khintchine representation for the generating function of multivariate logarithmic polynomials, deduces an integral representation for multivariate logarithmic polynomials, presents an integral representation for the reciprocal of the generating function of multivariate logarithmic polynomials, computes real and imaginary parts for the generating function of multivariate logarithmic polynomials, derives two integral formulas, and denies the uniform convergence of a known integral representation for Bernstein functions.

In the paper, by virtue of some properties for the Riemann zeta function, the author finds a double inequality for the ratio of two consecutive Bernoulli numbers with even indexes and analyzes the approximating accuracy of the double inequality.

In the paper, the author (1) presents an explicit formula and its inversion formula for higher order derivatives of generating functions of the Bell polynomials, with the help of the Faà di Bruno formula, properties of the Bell polynomials of the second kind, and the inversion theorem for the Stirling numbers of the first and second kinds; (2) recovers an explicit formula and its inversion formula for the Bell polynomials in terms of the Stirling numbers of the first and second kinds, with the aid of the above explicit formula and its inversion formula for higher order derivatives of generating functions of the Bell polynomials; (3) constructs some determinantal and product inequalities and deduces the logarithmic convexity of the Bell polynomials, with the assistance of the complete monotonicity of generating functions of the Bell polynomials. These inequalities are main results of the paper.

In the paper, the authors find two explicit formulas and recover a recursive formula for the generalized Motzkin numbers. Consequently, the authors deduce two explicit formulas and a recursive formula for the Motzkin numbers, the Catalan numbers, and the restricted hexagonal numbers respectively.

As the global population rapidly ages with longer life expectancy and declining birth rates, the need for healthcare services and caregivers for older adults is increasing. Current research envisions addressing this shortage by introducing domestic service robots to assist with daily activities. The successful integration of robots as domestic service providers in our lives requires them to possess efficient manipulation capabilities, provide effective physical assistance, and have adaptive control frameworks that enable them to develop social understanding during human-robot interaction. In this context, human factors, especially quantifiable ones, represent a necessary component. The objective of this paper is to conduct an unbiased review encompassing studies on human factors studied in research involving physical interactions and strong manipulation capabilities. We identified the prevalent human factors in physical human-robot interaction (pHRI), noted the factors typically addressed together and determined the frequently utilized assessment approaches. Additionally, we gathered and categorized proposed quantification approaches based on measurable data for each human factor. We also formed a map of common contexts and applications addressed in pHRI for a comprehensive understanding and easier navigation of the field. We found out that most of the studies in direct pHRI (when there is direct physical contact) focus on social behaviors with belief being the most commonly addressed human factor type. Task collaboration is moderately investigated, while physical assistance is rarely studied. In contrast, indirect pHRI (when the physical contact is mediated via a third item) studies often involve industrial settings, with physical ergonomics being the most frequently investigated human factor. More research is needed on human factors in direct and indirect physical assistance applications, including studies that combine physical social behaviors with physical assistance tasks. We also found that while the predominant approach in most studies involves the use of questionnaires as the main method of quantification, there is a recent trend that seeks to address quantification approaches based on measurable data.

In this paper, a new approach is proposed for designing ultra-low-power FFT (Fast Fourier Transform) system suitable for use in energy harvesting powered sensors. Bit-serial architecture is adopted to reduce the power consumption of butterfly operation. Simulation results show that, compared with state-of-the-art bit-serial and conventional parallel processors, the proposed technique is superior in terms of silicon area, power consumption, dynamic energy use due to variable precision arithmetic. A sample design of a 64-point FFT shows that the implementation can save about 40% area and 36% leakage power compared with a conventional parallel counterpart, accordingly achieving significant power benefits at a low sample rate and low voltage domain. The dynamic variation of the arithmetic precision can be achieved through a simple modification of the controller with hardware area overhead of 10% gate count.

China is in the climbing phase of the "Inverted U" environmental Kuznets curve, from excessive environmental consumption to the development stage of governance and protection, and green innovation. It is the most complex period of environmental quality. Environmental and policy regulation are very important. Select panel data of 29 provinces of China (excluding Hong Kong, Macau, Taiwan, Hainan and Tibet) from 2008 to 2017, construct a nonlinear two-threshold regression model, empirically analyse the impact of environmental tax and government innovation subsidies to green processes innovation, and attempt to explore whether the implementation of these two policies at the same time can make enterprises more inclined to green process innovation and whether there is an optimal space for policy implementation. It is proposed that the synergy effect of environmental tax and government innovation subsidy policies on enterprise green process innovation should be fully utilized, and the enterprise green process innovation environment and incentive mechanism should be improved to promote the green transformation and sustainable development of enterprises.

Cellular senescence has recently been recognized as a hallmark of cancer, reflecting its association with aging and inflammation, its role as a response to deregulated proliferation and oncogenic stress, and its induction by cancer therapies such as radiation, chemotherapy, and targeted agents. While such therapy-induced senescence (TIS) has been linked to resistance, recurrence, metastasis and normal tissue toxicity, TIS has the potential to enhance therapy response and stimulate anti-tumor immunity. In this review, we examine the Jekyll and Hyde nature of senescent cells (SnCs), with a particular focus on how their persistence while expressing the senescence-associated secretory phenotype (SASP) modulates the tumor microenvironment through autocrine and paracrine mechanisms. Via the SASP, the formation of SnCs may alternately mediate resistance or response to conventional therapy. Further, toward fulfilling the unmet potential of cancer immunotherapy, we consider how SnCs may influence tumor inflammation and serve as a source of antigen to potentiate anti-tumor immunity. This new view suggests treatment strategies based on inducing TIS to enhance immune checkpoint blockade. Finally, we describe strategies for mitigating the detrimental effects of senescence, such as modulating the SASP or targeting SnC persistence, toward enhancing the benefits of cancer treatment.

In recent years, there has been significant growth in the ubiquity and popularity of three dimensional(3D) point clouds, with an increasing focus on the classification of 3D point clouds. To extract richer features from point clouds, many researchers have turned their attention to various point set regions and channels within irregular point clouds. However, this approach has limited capability in attending to crucial regions of interest in 3D point clouds and may overlook valuable information from neighboring features during feature aggregation. Therefore, this paper proposes a novel 3D point cloud classification method based on global attention and adaptive graph convolution. The method consists of two main branches: the first branch com-putes attention masks for each point, while the second branch employs adaptive graph convolu-tion to extract global features from the point set. It dynamically learns features based on point interactions, generating adaptive kernels to effectively and precisely capture diverse relationships among points from different semantic parts. Experimental results demonstrate that the proposed model achieves 93.8% in overall accuracy and 90.8% in average accuracy on the ModeNet40 dataset.

In this paper, we study the well-posedness and asymptotic behaviour of solutions to a laminated beam in thermoelasticity of type III. We first give the well-posedness of the system by using the semigroup method. Then, we show that the system is exponentially stable under the assumption of equal wave speeds. Furthermore, it is proved that the system is lack of exponential stability for case of nonequal wave speeds. In this regard, a polynomial stability result is proved.

With the advancement of the economy and society, policymakers acknowledge the significance of improving rural households' well-being as a crucial factor in promoting sustainable economic and social development. Based on the matching data of China Household Finance Survey and Digital Rural County Index, this study empirically examines the effect and mechanisms of digital village construction on subjective well-being of rural households. The results revealed that digital village construction has a significant improvement in their subjective well-being. The impact of digital village construction is particularly significant in rural areas located in the western regions of China, as well as among households possessing higher levels of human capital. The process through which digital village construction enhances the subjective well-being of rural households involves the augmentation of household income, the promotion of non-farm employment opportunities, and the enhancement of rural governance. This study provides robust micro-empirical evidence highlighting the positive welfare effects of digital rural construction. This study provides insights into the digital village construction within the happiness economy framework, offering a new perspective. The imperative to strengthen rural digital infrastructure and improve farmers' proficiency in modern information skills is a strategic policy aimed at enhancing well-being of rural households.

Gestational Diabetes Mellitus (GDM) is related with adverse outcomes for both the mother and the offspring. Immune and senescence play a crucial role in GDM progression. This study aims to explore the diagnostic significance of immune-related senescence (IRS) genes in GDM. We used weighted gene co-expression network analysis (WGCNA) and single sample gene set enrichment analysis (ssGSEA) to compute the immune score and aging score in control and GDM samples. Machine learning identified core IRS genes. Then we performed unsupervised cluster analysis in GDM patients to explore immune infiltration. Finally, we validated the core genes in clinical samples. We used the intersection of MEblack module from WGCNA and differentially expressed genes (DEGs) to obtain the potential genes. Next, a univariate logistic regression model including 23 potential genes were constructed, and these genes were filtered by least absolute shrinkage and selection operator (LASSO) algorithm. There were 5 potential genes (COX17, RRAS2, RRAGC, CECR1, and TACC2), which defined as biomarkers, remained eventually, and the efficacy of these biomarkers was evaluated by nomogram. Finally, the results from both qRT-PCR and western blot analyses demonstrated CECR1 was down-regulated, while TACC2 was up-regulated in GDM placental tissue. Our study identified CECR1 and TACC2 as diagnostic biomarkers for GDM associating with immune and senescence, providing a new perspective on GDM progression.

In the paper, the authors establish two identities to express the generating function of the Chebyshev polynomials of the second kind and its higher order derivatives in terms of the generating function and its derivatives each other, deduce an explicit formula and an identities for the Chebyshev polynomials of the second kind, derive the inverse of an integer, unit, and lower triangular matrix, present several identities of the Catalan numbers, and give some remarks on the closely related results including connections of the Catalan numbers respectively with the Chebyshev polynomials, the central Delannoy numbers, and the Fibonacci polynomials.

The three-phase separator was perforated after four years’ service. The perforation position is at the bottom of the vessel under the baffle plate in an oil transfer station. The cause of perforation was investigated by chemical analysis using a direct-reading spectrometer, microstructure examined by optical microscope(OM), and lab simulated corrosion experiments by electrochemical workstation, and the corrosion products examined with scanning electron microscopy(SEM), energy dispersive spectrometer(EDS) in this paper. The analyses indicated that the coating at the base of the pressure vessel failed and this led to the direct exposure of the carbon steel plate to the corrosive medium. The electrical contact between the carbon steel and the stainless steel, sets up a galvanic cell that accelerated the corrosion of the pressure vessel which eventually led leads to the perforation.

Currently, efficient utilization of low-grade thermal energy is a great challenge. Thermoelectricity is an extremely promising method of generating electrical energy from temperature differences. As a promising energy conversion technology, thermo-electrochemical cells (TECs) have attracted much attention in recent years for their ability to convert thermal energy directly into electricity with high thermal power. Within TECs, anions and cations gain and lose electrons, respectively at the electrodes using the potential difference between the hot and cold terminals of the electrodes by redox couples. Additionally, the anions and cations therein are constantly circulating and mobile via concentration diffusion and thermal diffusion, providing an uninterrupted supply of power to the exterior. This review article focuses mainly on the operation of TECs, recent ad-vances in redox couples, electrolytes, and electrodes. The outlook for optimization strategies re-garding TECs is also presented in this paper.

This study utilises NaOH to treat composite cementitious materials containing aeolian sand and zeolite powders, which were used to replace 50% of the cement in aeolian-sand concrete (ASC). The mechanical properties of treated ASC considerably improved, especially when the NaOH dosage was 4% by mass. After curing this sample (denoted as AAZC-4) for 28 d, its compressive strength improved by 17.2% and its split tensile was increased by 16.3%. Potassium feldspar and montmorillonite in zeolite powder and SiO2 in the sand were decomposed by OH− and combined with other elements to generate various silicate gels and A-type potassium zeolite crystals inside the concrete. Microscopic examination showed that the gels and crystals intertwined to fill the pores, decreasing (increasing) the percentage of large (small) pores, thus optimising the pore structure. This substantially improved the mechanical properties of ASC. Freeze–thaw salt-intrusion tests showed that the extent of mass loss, degree of damage and loss of compressive strength of AAZC-4 were similar to those of ordinary concrete but were reduced by 36.8%, 19% and 52.1%, respectively, compared with those of ASC. Therefore, AAZC-4 has sustainable working performance in the chloride ion permeable environment in cold and arid areas.

Anthocyanins extract from purple tomato (PTA) was incorporated with polyvinyl alcohol (PVA) so that a series of colorimetric films of PVA/PTA (based on PVA) were prepared. The role of anthocyanin on color response, FTIR, thickness, water content, mechanical properties, antioxidant activity, and permeation of water vapor through the films was examined. In addition, its application in smart packaging to assess the freshness of shrimp was studied. It was found that the tensile strength, contact angle and WVP of PVA/PTA films increases with the addition of more PTA, while the elongation at break and water content decreased. FTIR analysis showed that there are interactions between PTA and PVA matrix. The addition of anthocyanins caused to a significant improvement for the antioxidant properties of PVA films. Furthermore, the total volatile alkaline nitrogen (TVB-N), total plate count (TPC) and pH value of shrimp were monitored after 4 days of refrigeration, and the color change of the indexes was recorded. The PVA/PTA films changed color from purple to yellow-green during the storage time of 0-4d for shrimp, this suggests that the film could be used in smart packaging as a real-time freshness indicator for shrimp.

The exploration and identification of targets and pathways for Atopic dermatitis (AD) treatment and diagnosis are critical for AD control. The conventional target exploration approach such as the literature review is not satisfying in terms of efficiency and accuracy. Recently, the bioinformatic approach is drawing attention for its unique advantage of high-volume data analysis for target and pathway exploration; Open Targets Platform is the targets source for this study to extract top 200 high-rank proteins from 3122 AD associated proteins. STRING, Cytoscape, CytoHubba, ClueGo, and CluePedia function had been applied for data analysis. The KEGG Mapper search & colour pathway was the pathway map resource for identified pathways; 23 key hub genes (VDR, KIT, BCL2L11, NFKBIA, KRAS, IL13, JAK2, STAT3, IL21, IL4R, REL, PDGFRB, FOXP3, RARA, RELB, EGFR, IL21R, MYC, CREBBP, NR3C1, IL2, JAK1, and KITLG). Additionally, 8 correlated pathways and the biological process had been identified; Through this study, a viable approach for target and pathway exploration had been presented. The identified AD targets and pathways will be tested for upcoming research for traditional Chinese medicinal herb interactions

The data assimilation method to improve sea fog forecast over the Yellow Sea is usually three-dimensional variational assimilation (3DVAR), whereas ensemble Kalman filter (EnKF) has not yet been applied on this weather phenomenon. In this paper, two sea fog cases over the Yellow sea, one spread widely and the other spread narrowly along the coastal area, are studied in detail by a series of numerical experiments with 3DVAR and EnKF based on the Grid-point Statistical Interpolation (GSI) system and the Weather Research and Forecasting (WRF) model. The results show that the assimilation effect of EnKF outperforms that of 3DVAR: for the widespread-fog case, the probability of detection and equitable threat scores of the forecasted sea fog area get improved respectively by ~57.9% and ~55.5%; the sea fog of the other case completely mis-forecasted by 3DVAR is produced successfully by EnKF. These improvements of EnKF relative to 3DVAR are benefited from its flow-dependent background error, resulting in more realistic depiction of sea surface wind for the widespread-fog case and better moisture distribution for the other case in the initial conditions. More importantly, the correlation between temperature and humidity in the background error of EnKF plays a vital role in the response of moisture to the assimilation of temperature, which leads to a great improvement on the initial moisture conditions for sea fog forecast.

A Mw7.8 earthquake struck Turkey on February 6, 2023, causing severe casualties and economic losses. This paper investigates the characteristics of strong ground motion and seismogenic fault of the earthquake. We collected and processed the strong ground motion records of 379 stations using Matlab, SeismoSignal and Surfer software, and obtained the peak ground acceleration (PGA) contour map. We analyzed the near-fault effect, the fault locking segment effect and the trampoline effect of the earthquake based on the spatial distribution of PGA, the fault geometry and slip distribution. We found that the earthquake generated a very strong ground motion concentration effect in the near-fault area, with the maximum PGA exceeding 2000cm/s2. However, the presence of fault locking segments influenced the spatial distribution of ground motion, resulting in four significant PGA high-value concentration areas at a local dislocation, a turning point and the end of the East Anatolian Fault. We also revealed for the first time the typical manifestation of the trampoline effect in this earthquake, which was characterized by a large vertical acceleration with the positive direction significantly larger than the negative direction. This paper provides an important reference for understanding the seismogenic mechanism, damage mode, characteristics and strong earthquake law of Turkey earthquake.

In this work, we try to find a way to describe the physical law of micro-world under the frame of a space-time theory. By introducing the scalar fields $\mathcal{D}\left( x\right)$ and $\zeta\left( x\right) $, we rewrite the action of conventional field theory and the Lagrangian describing the motion of the particle, where a modified space-time relation is obtained. To test the correctness of this attempt, we demonstrate the Klein-Gordon equation by the Hamilton-Jacobi method in four dimensional form and present a time delay for the ground state of hydrogen atom.

Orogenic antimony-gold deposits contribute significantly to the global antimony resource base. China's orogenic antimony-gold deposits are primarily in southern Tibet. Investigations indicate that antimony combines and migrates with sulfur hydroxides in ore-forming fluids. Previous research on fluid inclusions in orogenic antimony-gold ores with sedimentary rock accommodation revealed the presence of organic inclusions, including liquid hydrocarbons, alongside common components such as CO2, H2O, CH4, and NaCl. However, the impact of liquid hydrocarbons on antimony migration and mineralization is still de-batable. To investigate the transportability of antimony by liquid hydrocarbons in orogenic antimony ores, we selected n-dodecanethiol and n-dodecane as the subjects. We measured the solubility and occurrence form of antimony in these compounds at various temperatures and durations. The results indicate that after 5 and 10 days of reaction at 100 °C, the antimony concentrations in the n-dodecanethiol and n-dodecane groups were 67.44±7.62 ppm, 75.15±16.74 ppm, 1.40±1.02 ppm, and 3.02±3.09 ppm, respectively. At 150 °C for 5 and 10 days, the respective concentrations were 50.58±5.39 ppm, 77.26±45.20 ppm, 2.66±3.08 ppm, and 2.41±2.03 ppm. At 200 °C for 5 and 10 days, the corresponding concentrations were 339.76±71.94 ppm, 218.97±25.03 ppm and 6.53±7.17 ppm, 2.27±0.82 ppm (n=3). The measured solubility of antimony in the n-dodecanethiol group increased gradually with rising temperature. The solubility of antimony in the n-dodecane group was low and notably inferior to that observed in the n-dodecanethiol group. X-ray photoelectron spectroscopy (XPS) analysis demonstrated a distinct thiol (R-SH) peak at 163.31 eV and compound peaks of antimony reacting with thiols at 162.06 and 160.87 eV. This suggests that antimony predominantly forms complexes with thiols for migration. Our findings suggest that specific liquid hy-drocarbon components, predominantly thiols, can interact with antimony at metallogenic temperatures and persist in ore-forming fluids, facilitating migration and mineral enrichment. Earlier experimental studies on gold and crude oil have indicated that liquid hydrocarbons also play an essential role in the transportation and enrichment of gold during the formation of gold deposits, thus indicating that liquid hydrocarbons possess the considerable potential to act as an ore-forming fluid during orogenic antimony-gold deposit formation in southern Tibet.

Wind power generation is one of the mainstream renewable energy resources. Voltage stability is as important as the frequency stability of a power system with a high penetration of wind power generation. The advantages of high-voltage direct current (HVDC) transmission systems become more significant with the increase of both installed capacity and transmission distance in offshore wind farms. Therefore, this study discusses about various voltage control methods for wind turbines and HVDC transmission systems. First, various voltage control methods of a wind farm were introduced, and they include QV control and voltage droop control. The reactive power of a wind turbine varies with active power, while the active power from each wind turbine may be different owing to wake effects. Thus, QV and voltage droop control with varying gain values were also discussed in this paper. Next, the voltage control methods for a HVDC transmission system, such as power factor control, voltage control, and Vac-Q control, are also summarized and tested in this study. When a three-phase short circuit fault occurs or a suddan reactive power load increases, the system voltage would drop immediately. Thus, various voltage control methods for wind turbines or HVDC can make the system's transient response more stable. Therefore, this study implemented the simulation scenarios, including a three-phase short circuit fault at the point of common coupling (PCC) or a sudden increase of reactive power load, and adopted various voltage control methods, which aims to verify whether additional voltage control methods are effective to improve the performance of transient voltage.

Bipedal locomotion remains one of the major open challenges of humanoid robotics. The common approaches are based on simple reduced model dynamics to generate walking trajectories, often neglecting the whole-body dynamics of the robots. As motions in nature are often considered as optimal with respect to certain criteria, in this work we present an optimal control based approach that allows us to generate optimized walking motions using a precise whole-body dynamic model of the robot, in contrast with the common approaches. The optimal control problem is formulated to minimize a set of desired objective functions with respect to physical constraints of the robot and contact constraints of the walking phases. We apply the method with combinations of different objective criteria to the model of a reduced version of the iCub humanoid robot of 15 internal DOF. The obtained trajectories are executed on the real robot and we carry out a discussion on the differences between the outcomes of this approach with the classic approaches.

The merge areas of freeway work zones include relatively significant safety hazards that have continuously led to urgent safety issues to be solved by the management departments. In order to make up for the cumbersome process of independent identification of rear-end collision and lane change collision on complex road sections, an appropriate identification method of traffic conflicts in the merge area of freeway work zone was explored, this study collected vehicle running tracking data from the merge areas of multiple work zones, using an unmanned aerial vehicle video technique. Based on an inter-frame difference method and the principle of a spatio-temporal context visual tracking algorithm, the vehicles were detected and tracked, and the coordinate data of the vehicles in continuous motion were parsed using MATLAB extension tools. Based on the behavior characteristics of vehicle conflict avoidance, a new identification method for evading severe traffic conflicts is proposed according to the initial velocity, acceleration and accident rate of section traffic. Then, a statistical analysis was performed on the spatial distribution characteristics of the traffic conflicts in typical merge areas. The impacts of the road conditions in work zones, vehicle factors, and traffic flow factors on the traffic conflicts were analyzed. A binomial logistic model was established to identify the main influencing factors. The results show that in the merge area of the freeway work zone, there are serious traffic conflicts between vehicles in the following two situations: (Ⅰ) v∈[7,13.5] m/s and a∈[-3.96,-0.65]m/s2; and (Ⅱ) v∈[13.5,24.3] m/s, and a∈[-3.96,-1.57] m/s2. The probabilities of serious traffic conflicts in the first and last 25 m of the merge area are greater than those in the other sections. The smaller the space between the upstream work zone and the merge area, the greater the probability of serious traffic conflicts between vehicles. When the average vehicle speed is relatively high, the probability of serious conflicts is the highest, i.e., by a multiple of 5.95 from the baseline. Moreover, the probability of serious conflicts between vehicles is higher for larger vehicles, i.e., 4.765 times that for small vehicles. The research results can serve as a reference for freeway management departments to improve the safety levels of merge areas during road work. For example, the probability of serious conflicts can be effectively reduced by setting up reasonable speed limit signs in the work zone, increasing the spacing between work zone and merge area, and appropriately diverting large vehicles.

In order to meet the military requirements of the fuze, such as precision strike, efficient mutilates ability and low collateral damages, the microminiaturization is an inevitable trend of secure system. Based on the silicon-based MEMS S&A device designed by our term, the design principles of each module and fabrication process are introduced. The average fracture strength and Young's modulus of the silicon are 726 MPa and 175 GPa from the tensile test, respectively. From Hopkinson impact experiment, we can get the threshold-value judging mechanism being safety under the impact overload of 20526 g, and this value is much more than the standard of the drop overload 12000g; the arming value under the centrifugal overload obtained from theory, simulation and experiment is at the range of 28200 g and 32000 g, it shows that the threshold-value judging mechanism can be arming compared with the value 35951g of design principle. Therefore, the threshold-value judging mechanism can meet the design requirements of overload. Furthermore, the relationship of fracture threshold-values obtained by different theories is found out through parametric design method, as shown in Figure 14, it provides the theory evidence to the follow parametric design.

Using machine learning or deep learning to solve the problem of garbage recognition and classification is an important application in computer vision, but due to the incomplete establishment of garbage datasets and the poor performance of complex network models on smart terminal devices, the existing garbage classification models The effect is not good.This paper presents a waste classification and identification method base on transfer learning and lightweight neural network. By migrating the lightweight neural network MobileNetV2 and rebuild it, The reconstructed network is used for feature extraction, and the extracted features are introduced into the SVM to realize the identification of 6 types of garbage. The model was trained and verified by using 2527 pieces of garbage labeled data in the TrashNet dataset, which ultimately resulted in a classification accuracy of 98.4% of the method, which proves that the method can effectively improve the classification accuracy and time and overcome the problem of weak data and less labeling. The over-fitting phenomenon encountered by small data sets in deep learning makes the model robust.

Saudi Arabia is a prominent producers of dates, with 1.6 million tons annually. There is a need to evaluate physical properties and quality of fruits non-destructively and then be modeled and predicted throughout the storage period. The aim of the current study was to generate a quality index (Qi) and Near-infrared spectra (NIR) models non-destructively to predict properties of Barhi dates fruits including objective and sensory evaluations. The engineering properties of Barhi dates were measured and modeled with quality index (Qi) based on NIR of fresh Barhi fruits (hardness, color, TSS, pH, and sensory evaluations) and during storage in cold, ambient, and controlled at-mosphere (CA) for up to four months. The prediction of Qi is non- destructively based on NIR utilizing PLSR and ANN data analysis. The results showed that the Qi generated corresponds with high precision to the characteristics of the examined fruits through the duration of the storage period with R2 of 0.96. The NIR spectrum proves to be an efficient method to evaluate the Barhi fruits' quality index. where ANN was found to be more suitable than PLSR analysis. Thus, NIR can be utilized to accurately predict the Qi of fruits quality effectively throughout the handling, processing, transporting, storage, and retail sector supply chain.

Underwater image often exhibit detail blurring and color distortion due to light scattering, impurities, and other influences, obscuring essential textures and details. This presents a challenge for existing super-resolution techniques in identifying and extracting effective features, making high-quality reconstruction difficult. This research aims to innovate underwater image super-resolution technology to tackle this challenge. Initially, an underwater image degradation model was created by integrating random subsampling, Gaussian blur, mixed noise, and suspended particle simulation to generate a highly realistic synthetic dataset, thereby training the network to adapt to various degradation factors. Subsequently, to enhance the network's capability to extract key features, improvements were made based on the symmetrically structured Blind Super-Resolution Generative Adversarial Network (BSRGAN) model architecture. An attention mechanism based on energy functions was introduced within the generator to assess the importance of each pixel, and a weighted fusion strategy of adversarial loss, reconstruction loss, and perceptual loss was utilized to improve the quality of image reconstruction. Experimental results demonstrate that the proposed method achieved significant improvements in Peak Signal-to-Noise Ratio (PSNR) and Underwater Image Quality Measure (UIQM) by 0.85 dB and 0.19, respectively, significantly enhancing the visual perception quality and indicating its feasibility in super-resolution applications.

Pneumonia remains a major cause of morbidity and mortality worldwide, especially during COVID-19 pandemic. With the significant global health burden that pneumonia poses, it is es-sential to improve therapeutic and management strategies. The increasing emergence of antibiotic resistant bacterial strains limits options for effective antibiotic use. New antibiotics for treatment of pneumonia may address deficits in current antimicrobial drugs, with an ability to cover both typical, atypical, and resistance pathogen. Several of these newer drugs also have structural characteristics that allow for a decreased propensity in development of bacterial resistance. Po-tential use of stem cell therapies in place of corticosteroid treatments may also offer an im-provement in patient outcomes. Human mesenchymal stem cell treatments have shown efficacy and safety in treating COVID-19 induced pneumonia. Combined treatment with both stem cells and antibiotics in pneumonia in a rabbit model has also shown significantly increased efficacy in comparison to antibiotic treatment alone, presenting yet another possible route for a novel strategy in treating pneumonia, though additional future studies are necessary before clinical implementation. While pneumonia remains a major disease of concern, having newer approved antibiotics as well as novel therapies such as stem cell treatments in the pipeline offers clinicians more options in effectively treating pneumonia.

Deep learning has achieved remarkable success in diverse computer science applications, however, its use in other traditional engineering fields has emerged only recently. In this project, we solved several mechanics problems governed by differential equations, using physics informed neural networks (PINN). The PINN embeds the differential equations into the loss of the neural network using automatic differentiation. We present our developments in the context of solving two main classes of problems: data-driven solutions and data-driven discoveries, and we compare the results with either analytical solutions or numerical solutions using the finite element method. The remarkable achievements of the PINN model shown in this report suggest the bright prospect of the physics-informed surrogate models that are fully differentiable with respect to all input coordinates and free parameters. More broadly, this study shows that PINN provides an attractive alternative to solve traditional engineering problems.

In the paper, the authors establish two identities, which can be regarded as nonlinear differential equations, for the generating function of Eulerian polynomials, find two identities for the Stirling numbers of the second kind, and present two identities for Eulerian polynomials and higher order Eulerian polynomials, pose two open problems about summability of two finite sums involving the Stirling numbers of the second kind. Some of these conclusions meaningfully and significantly simplify several known results.

Rollover prevention of partially-filled tank trucks is an industry teaser, with the core challenge being real-time perception and observation of the liquid state inside the tank. In order realize re-liable observation of sloshing liquid, this article firstly proposes a sloshing modeling method based on multi-degree-of-freedom pendulum model, and derives the double mass trammel pendulum model (DMTP, 2DOF) accordingly, which accurately reflects the sloshing dynamics under more pervasive working conditions. Secondly, a free surface fluctuation sensor is designed based on magnetostriction, capable of measuring the inclination and height of the liquid level inside tanks filled with hazardous chemical. Finally, the unscented Kalman filter (UKF) is utilized to synthesize the information of the two, establishing a credible real-time observation of the sloshing liquid. Verified through vehicle-fluid coupled co-simulation, under condition of con-secutive double lane change, observation error of the proposed method is only 25.9% that of the open-loop calculation, providing a secure guarantee for the observation of the state variables of the single pendulum model (SP) used for most kinds of anti-rollover controller.

MEMS (Micro-electromechanical Systems) becomes important increasingly due to the smarter and smaller fuze used in OICW (Objective Individual Combat Weapon). MEMS Safety and Arming (S&A) device is employed in different platforms and regions for small caliber projectile. Therefore, it is necessary to make a parametric study of the MEMS S&A device in different apply environments and explore the main sensitive factors of the MEMS S&A device to provide reference for designs. In this paper, based on the MEMS S&A device designed by our term, theory and finite element models are established, and the centrifugal insurance mechanism of the MEMS S&A device is parametric studied under the different speeds, temperature and thickness of the model by nonlinear dynamic method. By comparing the experimental and predicted results, the established FEM model is verified, and the conclusion is that the temperature and the centrifugal force are the main sensitive factors in the centrifugal insurance mechanism. In summary, we can suggest that the application environment, which the MEMS S&A device is suitable for, is the temperature equal to or slightly greater than normal temperature and the rotating speed higher than35000r/min of small caliber projectile.

Objective: To sort out the research hotspots of the application of VR in rehabilitation medicine, analyse its research themes and research trends, and offer a reference for future related research in this field. Methods: This paper provides an in-depth analysis of the development process, research hotspots and research trends in the field of VR application in rehabilitation medicine research, taking the Web of Science core dataset as the source and using bibliometric analysis by CiteSpace. Results: The application of VR in rehabilitation medicine was composed of three stages, and the research topics were reviewed in five aspects: neurological rehabilitation, psychology treatment, pain distraction, cardiopulmonary rehabilitation, and visual spatial disorder. Limitations: The literature data only come from the Web of Science core dataset, and the data sample size was not comprehensive. Conclusion: Overcoming VR technology-induced vertigo and mental disorders from overuse of VR are both challenges to research on the application of VR in rehabilitation medicine. In addition, developing VR products with better experience, developing standardized guidelines, and conducting more high-quality clinical studies are all future research trends for the application of VR in rehabilitation medicine.

Territory space is an ecological resource carrier and place for human development. Human activities and ecological systems are the basis of ecological product supply. Promoting territory spatial protection and governance by improving the ecological products supply is very important. In this study, we established an ecological products supply capacity evaluation index system involving three types of ecological products, i.e., ecological environmental products, ecological material products, and ecological cultural products. For the case of the Beijing-Tianjin-Hebei region, we comprehensively used principal component analysis, equivalent factor method, and entropy method to evaluate the supply capacity of the ecological products from 2011 to 2021. Then, we analyzed the spatio-temporal pattern combining the natural breakpoint and quantile classification methods and analyzed the obstacle factors using the obstacle degree model of ecological supply. The results show that the supply capacity of different ecological product in each city are closely related to ecological resource endowment. The supply capacity of ecological products exhibited an upward trend, with the highest ecological environmental products supply, relatively smaller ecological material product supply, and the largest growth rate for ecological cultural product supply. The supply capacity of different ecological products varied across cities over time and displayed noticeable spatial differentiation. The main obstacle factors included eco-land, eco-tourism, eco-leisure, park green space, and fishery products, although there were variations among cities. Finally, based on the level, spatial-temporal pattern, and obstacle factors of ecological product supply, we proposed strategies for territory spatial protection and governance from the perspectives of integrated protection of elements, structural regulation, and systematic governance. The results reflected the ecological functional heterogeneity of territory space, which can provide spatial planning guidance for sustainable development.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Manual interpretation of these huge amounts of image volumes are susceptible to inter-reader variability and human error. Thus, accurate automated CAD scheme is highly desirable in clinical pathological diagnosis. In this research, plethora of machine learning paradigms (e.g. feature extraction, dimensionality reduction and supervised classification methods) were explored, evaluated, compared and analyzed to identify the optimal pathway for brain MR images (normal vs neoplastic) binary classification task. External validation dataset was used to test the generalizability of the optimal predictive models implemented. Relevant and informative features were selected to construct cross-validated decision tree and eventually simple rule set was built based on the decision tree. The experimental results show that almost all pattern recognition paradigms achieve high accuracy with careful selection of number of attributes. LDA+ELM with 55 features are the optimal pipelines which achieve perfect classification when training and test data are of same source; and achieving (accuracy=97.5%, AUC=0.989, sensitivity=95% and specificity=100%) under balanced test dataset; (accuracy=99.5%, AUC=0.988, sensitivity=95% and specificity=100%). Cross-validated decision tree model also shows comparable performance: accuracy=98.8%, AUC=99.1%, sensitivity=99.6% and specificity=98.2%. Three highly relevant and robust attributes are visualized and selected for construction of decision tree models and finally a rule sets are read directly off the decision tree. This rule sets can potentially serve as fast and accurate classification algorithm.

In the paper, the authors express the Fuss–Catalan numbers as several forms in terms of the Catalan–Qi function, find some analytic properties, including the monotonicity, logarithmic convexity, complete monotonicity, and minimality, of the Fuss–Catalan numbers, and derive a double inequality for bounding the Fuss–Catalan numbers.

Salvia hispanica (chia) is a highly nutritious food source and has gained popularity due to its high omega-3 fatty acid content. Red spider mites are a serious problem in the production of S. hispanica. However, no study has been conducted to analyse the defensive response to the infestation of red spider mites in S. hispanica. To elucidate the molecular mechanisms of the defensive response of S. hispanica to red spider mites, we performed a transcriptomic analysis of S. hispanica when infested by red spider mites. In the comparative assessment of leaf transcriptomes, a total of 1743 differentially expressed genes (DEGs) were identified between control and mite-infested S. hispanica. From these, 1208 (69%) transcripts were up-regulated and 535 (31%) were down-regulated. The DEGs included transcription factors, defense hormones, and secondary metabolites that were either suppressed or activated in response to spider mite herbivory. Gene Ontology (GO) enrichment analysis revealed that plant secondary metabolites such as glucosinolates, and signalling pathways, including the jasmonic acid signalling pathway, may play an important role in the defence against red spider mites. This study provides novel insights into the defence response of S. hispanica in response to insect herbivory and could be a resource for the improvement of pest resistance in the chia.

High-dimensional measurement error data are becoming more prevalent across various fields. Research on measurement error regression models has gained increasing attention due to the risk of drawing inaccurate conclusions if measurement errors are ignored. When the dimension p is larger than the sample size n, it is challenging to develop statistical inference methods for high-dimensional measurement error regression models due to the existence of bias, nonconvexity of objective function, high computational cost and many other difficulties. Over the past few years, some works have overcome the aforementioned difficulties and proposed several statistical inference methods. This paper mainly reviews the current development on estimation, hypothesis testing and variable screening methods for high-dimensional measurement error regression models and shows the theoretical results of these methods with some directions worthy of exploring for future research.

Version Control and Source Code Management Systems, such as GitHub, contain large amount ofunstructured historical information of software projects. Recent studies have introduced Natural Language Processing (NLP) to help software engineers retrieve information from very large collection of unstructured data. In this study, we have extended our previous study by increasing our datasets and ML and clustering techniques. Method: We have followed a complex methodology made up of various steps. Starting from the raw commit messages we have employed NLP techniques to build a structured database. We have extracted their main features and used as input of different clustering algorithms. Once labelled each entry, we have applied supervised machine learning techniques to build a prediction and classification model. Results: We have developed a machine learning-based model to automatically classify commit messages of a software project. Our model exploits a ground-truth dataset which includes commit messages obtained from various GitHub projects belonging to the HEP context. Conclusions: The contribution of this paper is two-fold: it proposes a ground-truth database; it provides a machine learning prediction model. They automatically identify the more change-proneness areas of code. Our model has obtained a very high average precision, recall and F1-score.

Service pricing is a bottleneck in the development of innovation services, as it is the issue of most concern between the suppliers and demanders. In this paper, a negotiation pricing model that is based on the multiobjective genetic algorithm is developed for innovation service pricing. Regarding the service pricing process as a multiobjective problem, the objective functions, which include the service price, service efficiency, and service quality, for suppliers and demanders are constructed. As the solution of a multiobjective problem is typically a series of alternatives, another negotiation process is necessary for determining the final decision. A learning strategy is adopted during the negotiation process to simulate reality. Finally, the model is implemented for an innovation service transaction, the objective of which is to identify the optimal price plan. The results demonstrate that the model can provide quantitative decision support for the pricing of an innovation service and ultimately yield a win-win result for both the supplier and demander of the innovation service. Furthermore, the influence of the parameters during the negotiation process is analyzed in detail. The effects of the learning strategy on accelerating the negotiation process, as well as the chosen of reasonable parameters are given.

The rapid development of 2019-2020 Wuhan seafood market pneumonia currently posed a major public health concern in China. Genome sequencing identified a novel beta-coronavirus closely related to SARS-CoV, named 2019-nCoV by WHO, as the cause of this pandemic disease. Viruses with single stranded RNA genome are prone to evolve quickly by accumulation of mutations, such as SNV, INDEL and cross viral recombination, aiding fast transmission among hosts and cross species. Here we collected related genome sequences and investigated variations shared by different strains of 2019-nCoV, identified reoccurrence of SNV mutations in clusters of patients, an indication of rapid evolution of 2019-nCoV at the transmission from animal host to human. The information collected herein would help to understand the dynamics of current pandemic.

The main parameters for calculation of relative humidity are the wet-bulb depression and dry bulb temperature. In this work, easy-to-used predictive tools based on statistical learning concepts, i.e., the Adaptive Network-Based Fuzzy Inference System (ANFIS) and Least Square Support Vector Machine (LSSVM) are developed for calculating relative humidity in terms of wet bulb depression and dry bulb temperature. To evaluate the aforementioned models, some statistical analyses have been done between the actual and estimated data points. Results obtained from the present models showed their capabilities to calculate relative humidity for divers values of dry bulb temperatures and also wet-bulb depression. The obtained values of MSE and MRE were 0.132 and 0.931, 0.193 and 1.291 for the LSSVM and ANFIS approaches respectively. These developed tools are user-friend and can be of massive value for scientists especially, those dealing with air conditioning and wet cooling towers systems to have a noble check of the relative humidity in terms of wet bulb depression and dry bulb temperatures.

Thought runs through the mind like blood runs through our body to keep us alive. Like the mind, the body does not stay inert and is in constant motion. Not a single cell in our body is left inert unless cell is under stress or dying. These scenarios are reflected upon when a person is sick, the person lies in bed with less movement; however, is active when the person is healthy. The topic of mechanical stimulation has emerged due to the increasing understanding of the physical stimulations we face each day. Further understanding of the mechanically-regulated mechanism can help us explore the pathological events in a disease. Here, we reviewed the role of sensory proteins in pathological events that are observed in cardiomyopathy, cancer, respiratory, renal, obesity, genetics, physical injury and bacterial infection. Taken together, sensory proteins are mechanically-activated which assist reception of external physical stimulation and convert into biochemical to trigger intracellular signaling cascade.

In recent years, the Chinese government pays more and more attention to agricultural development and ecological protection. While improving the cultivated land green use efficiency(CLGUE) is the key to promote the sustainable development of agriculture. This study aims to study the current situation and influencing factors of agricultural production from the perspective of green utilization efficiency of cultivated land. It takes 39 cities in the upper, middle and lower reaches of the Yangtze River basin in China as an example. The CLGUE values in those 39 cities from 2011 to 2020 were specifically measured, using the Super-SBM model, kernel density estimation and geographic detector method. Their temporal and spatial heterogeneity was described, and the influencing factors were detected at both single and interactive levels. The results showed that: （1）From 2011 to 2020, the green utilization efficiency value of cultivated land in the Yangtze River Basin showed an upward trend on the whole; （2）There is a clear spatial heterogeneity the CLGUE values in the Yangtze River Basin cities, as shown by: downstream region > midstream region > upstream region; (3) Cultivated land resource endowment, socioeconomic development, and agricultural production technology are important factors affecting the variability of CLGUE values. However, there are some differences in the degree and direction of influence of different influencing factors on different sample subgroups.

Polymethyl methacrylate (PMMA) polymer is widely used in various fields today. In order to thoroughly reveal the structural impact performance of PMMA materials, this paper is based on the comprehensive Johnson-Cook constitutive model and damage failure model, and accurately confirm the J-C constitutive and damage failure model parameters of PMMA through material test data, The dynamic process of steel bullet impacting PMMA plate structure is analyzed by finite element software ABAQUS. The calculation results show that the numerical simulation results in this paper are in good agreement with the experimental test data. Therefore, the feasibility and accuracy of the impact analysis of PMMA structures based on J-C constitutive and damage failure models in this paper are studied. Finally, based on the J-C constitutive model and damage failure model, the variation of the residual velocity of the bullet with the PMMA plate thickness is analyzed in depth, that is, the results show that the residual velocity of the bullet has a certain linear relationship with the plate thickness.

In the paper, the authors discover several series identities involving the Catalan numbers, the Catalan function, the Riemanian zeta function, and the alternative Hurwitz zeta function.

Abstract: The population issue has been increasingly urgent in China in recent years. Fertility desire is an essential component of fertility research. Studies on fertility desire mainly contain two aspects: socio-economic structure and individual family[1]. The psychological structure of individuals in individual families is the primary factor of fertility desire. Based on the parasocial relationship theory, this study analyzed the changes in real behavioral intention achieved by players through the identification and attachment to avatars while constructing parasocial relationships[2]. The results indicate that character attachment can significantly enhance the variables of game concentration and player self-identity, actively mediates parasocial emotions and parasocial cognition, and ultimately increases fertility desire. As a theoretical contribution, this study provides a comprehensive interpretation of the psychology of Chinese players in a Simulation Game and explores the theoretical connections among role attachment, role identity, and parasocial relationships in virtual game players.

The scope of this work was part of our previous research on Pulsed Power Plasma Stimulation Technique. Electromagnetic fields generated during a pulsed power plasma discharge were simulated using a finite element method in the COMSOL RF module. The field distributions were calculated during and after the pulse. The current paper takes advantage of prior work measuring and modeling the current distribution in the plasma arc. Agreement with laboratory experimental measurements provides support for extension of the model to reservoir scale. The validated model was used to quantify the signal attenuation level in different medium environment.

To investigate the impact of electrode structure on Electrical Stimulation Therapy (EST) for chronic wound healing, this study designed three variants of flexible microelectrodes (FMs) with Ag-Cu coverings (ACCs), each exhibiting distinct geometrical configurations: hexagonal, cross-shaped, and serpentine. These were integrated with PPY@PDA/PANI (3/6) hydrogel dressings. Comprehensive animal studies, coupled with detailed electrical and mechanical modeling and simulations, were conducted to assess their performance. Results indicated that the serpentine-shaped FM outperformed its counterparts in terms of flexibility and safety, exhibiting minimal thermal effects and a reduced risk of burns. Notably, FMs with metal coverings under 3% demonstrated promising potential for optoelectronic self-powering capabilities. Additionally, simulation data highlighted the significant influence of hydrogel non-uniformity on the distribution of electrical properties across the skin surface, providing critical insights for optimizing EST protocols when employing hydrogel dressings.

Despite the strong anticancer activity of SN38 (7-ethyl-10-hydroxy-camptothecin), some defects prevent its clinical application, such as severe side effects and loss of anticancer activity due to lack of selectivity to cancer cells and hydrolysis of ring E, respectively. To address the issue, herein a multifunctional SN38 derivative (compound 9) containing biotin (tumor-targeting group) and valproic acid (histone deacetylase inhibitor, HDACi) was synthesized via click chemistry and evaluated using MTT assay. The in vitro cytotoxicity study showed that compound 9 exhibited superior cytotoxicity as irinotecan against human cervical cancer HeLa cells, albeit inferior to SN38. More significantly, compound 9 significantly reduced toxicity in mouse embryonic fibroblast NIH3T3 cells, indicating that compound 9 had the capacity to enhance tumor targeting due to its cell selectivity. Further studies demonstrated that compared with irinotecan, compound 9 induced similar apoptosis of cancer cells. Consequently, compound 9 can not only improve its tumor-targeting ability mediated by biotin but also exert the potent anticancer activity through the synergism of SN38 and valproic acid, indicating that the design concept is an effective strategy for structural modification of SN38.

Aspergillus montevidensis is an important domesticated fungus that has been applied to produce many traditional fermented foods under high osmotic conditions. However, the detailed mechanisms of tolerance to osmotic stress remain largely unknown. Here, we construct a target-deleted strain (ΔLeuRS) of A. montevidensis and found that the ΔLeuRS mutants grew slowly and suppressed the development of the cleistothecium compared to the wide-type strains (WT) under salt-stressed conditions. Furthermore, differentially expressed genes (P<0.0001) governed by LeuRS were involved in salt tolerance, ABC transporter, amino acid metabolism, sugar metabolism, and reproduction process. The ΔLeuRS strains compared to WT strains under short- and long-term salinity stress especially altered accumulation levels of metabolites, such as amino acids and derivatives, carbohydrates, organic acids, and fatty acids. The study provides new insights into the underlying mechanisms of salinity tolerance and lays a foundation for favor improvement of foods fermented with A. montevidensis.

In the paper, by the Faά di Bruno formula, several identities for the Bell polynomials of the second kind, and an inversion theorem, the authors simplify coefficients of two families of nonlinear ordinary differential equations for the generating function of the Catalan numbers and discover inverses of fifteen closely related lower triangular integer matrices.

Molecular communication (MC) is a promising bio-inspired paradigm for exchanging molecule information among nanomachines. This paper proposes a synchronisation-assist photolysis MC system that aims to transmit the bio-sensing signal of the tumour microenvironment, facilitated by mitigating redundant molecules for improved bit error rate (BER) performance. Benefits from bio-compatible MC, biosensors could transmit bio-sensing signals of the tumour in $vivo$ instead of converting them to electrical signals. Due to diffusion motion's slow and stochastic nature, inter-symbol interference (ISI), resulting from previous symbols' residual information molecules, inevitably occurs in diffusion-based MC. ISI is one of the challenges in diffusion-based MC, which significantly impacts signal detection. Inspired by on-off keying (OOK) modulation, the proposed modulation implements a switch of molecules and light alternatively. The light emitted is triggered by a synchronisation signal, and the photolysis reactions could reduce the redundant molecules. An expression for the relevant channel impulse response (CIR) is derived from a hybrid channel model of diffusion and photolysis-reaction. This paper implements the maximum posterior estimation scheme to find the optimal decision threshold and analysis the BER performance in terms of different time intervals of the system. Numerical simulations demonstrate that the proposed method can improve the channel capacity and BER performance. We believe that our work may pave the way for MC application in bio-sensing.