We develop a primality test for Mersenne numbers and investigate the primality of the sequence of Catalan-Mersenne numbers. We use induction as a proof to show that the 5th Catalan-Mersenne number is a prime number, thus demonstrating the infinitude of Mersenne primes.

In this paper, we establish the generalized Qi-type inequality involving conformable fractional integrals. The results presented here would provide extensions of those given in earlier works.

In the paper, the authors discover several series identities involving the Catalan numbers, the Catalan function, the Riemanian zeta function, and the alternative Hurwitz zeta function.

In the paper, by virtue of a Lévy–Khintchine representation and an alternative integral representation for the weighted geometric mean, the authors establish a Lévy–Khintchine representation and an alternative integral representation for the Toader–Qi mean. Moreover, the authors also collect an probabilistic interpretation and applications in engineering of the Toader–Qi mean.

In the paper, the authors survey integral representations of the Catalan numbers and the Catalan–Qi function, discuss equivalent relations between these integral representations, supply alternative and new proofs of several integral representations, collect applications of some integral representations, and present sums of several power series whose coefficients involve the Catalan numbers.

In the paper, the authors express the Fuss–Catalan numbers as several forms in terms of the Catalan–Qi function, find some analytic properties, including the monotonicity, logarithmic convexity, complete monotonicity, and minimality, of the Fuss–Catalan numbers, and derive a double inequality for bounding the Fuss–Catalan numbers.

New setting is introduced to study chromatic number. Neutrosophic chromatic number and chromatic number are proposed in this way, some results are obtained. Classes of neutrosophic graphs are used to obtains these numbers and the representatives of the colors. Using colors to assigns to the vertices of neutrosophic graphs is applied. Some questions and problems are posed concerning ways to do further studies on this topic. Using strong edge to define the relation amid vertices which implies having different colors amid them and as consequences, choosing one vertex as a representative of each color to use them in a set of representatives and finally, using neutrosophic cardinality of this set to compute neutrosophic chromatic number. This specific relation amid edges is necessary to compute both chromatic number concerning the number of representative in the set of representatives and neutrosophic chromatic number concerning neutrosophic cardinality of set of representatives. If two vertices have no strong edge, then they can be assigned to same color even they’ve common edge. Basic familiarities with neutrosophic graph theory and graph theory are proposed for this article.

In the paper, by the Faά di Bruno formula, several identities for the Bell polynomials of the second kind, and an inversion theorem, the authors simplify coefficients of two families of nonlinear ordinary differential equations for the generating function of the Catalan numbers and discover inverses of fifteen closely related lower triangular integer matrices.

Background: Acute kidney disease (AKD) is a known risk factor for increased mortality and evolution towards chronic kidney disease (CKD) in adults. The data regarding children are scarce. The purpose of our study is to explore the risk factor for AKD and impact of AKD following an acute kidney injury (AKI) episode in children on mortality and new-onset CKD. Methods: We retrospectively evaluated 736 children with ages between 2 and 18 years old with AKI admitted in a tertiary care hospital from the west Romania over a 9 years period. Results: AKD incidence following AKI was 17%. Patients that developed AKD were older, with higher baseline serum creatinine values, urea, C reactive protein and lower proteins, haemoglobin and sodium. They were more often exposed to sepsis, critical illness and nephrotoxic medications and presented certain susceptibilities like CKD, neoplasia, anemia, heart failure, arterial hypertension, stem cell transplant and female gender. AKI causes that increased the risk of AKD were intrinsic ones. AKD increased the overall mortality by three times. The factors that independently increased the risk of evolution towards CKD were AKD, acute tubular necrosis and higher baseline serum creatinine values. Conclusions: AKD is an independent risk factor for mortality and new-onset CKD in children.

Design criteria for coastal defenses exposed to wave overtopping are usually assessed by mean overtopping discharges and maximum individual overtopping volumes. However, it is often difficult to give clear and precise limits of tolerable overtopping for all kind of layouts. A few studies analyzed the relationship between wave overtopping flows and hazard levels for people on sea dikes, confirming that one single value of admissible mean discharge or individual overtopping volume is not a sufficient indicator of the hazard, but detailed characterization of flow velocities and depths is required. This work presents the results of an experimental campaign aiming at characterizing the flow characteristics associated to maximum individual overtopping volumes for an urbanized stretch of a town along the Catalan coast, where a walking and bike path and a railway run along the coastline are exposed to significant overtopping events every stormy season. The work compares different safety criteria for pedestrian. Results prove that safety of pedestrian on a sea dike can be still guaranteed even for overtopping volumes larger than 1000 l/m. Pedestrian hazard is rather proved to be linked to the combination of overtopping flow velocity and flow depth.

We introduce a full binary directed tree structure to represent the set of natural numbers, further categorizing them into three distinct subsets: pure odd numbers, pure even numbers, and mixed numbers. We adopt a binary string representation for natural numbers and elaborate on the composite methodology encompassing odd- and even-number functions. Our analysis focuses on examining the iteration sequence (or composition) of the Collatz function and its reduced variant, which serves as an analog to the inverse function, to scrutinize the validity of the Collatz conjecture. To substantiate this conjecture, we incorporate binary strings into an algebraic formula that captures the essence of the Collatz sequence. By this means, we transform discrete powers of 2 into continuous counterparts, ultimately culminating in the smallest natural number, 1. Consequently, the sequence generated through infinite iterations of the Collatz function emerges as an eventually periodic sequence, thereby validating an enduring 87-year-old conjecture.

Semi-continuous data are very common in the social science and economics. In this paper, a Bayesian variable selection procedure is developed to assess the influence of exogenous factors including observed and unobserved on the semi-continuous data. Our formulation is based on the two-part latent variable model with polytomous response. We consider two schemes for the penalties of regression coefficients and factor loadings: the Bayesian spike and slab bimodal prior and the Bayesian lasso prior. Within the Bayesian framework, we implement Markov Chains Monte Carlo sampling method to conduct posterior inference. To facilitate posterior sampling, we recast the logistic model in part one as the norm-like mixture model. Gibbs sampler is designed to draw observations from the posterior. Our empirical results show that with suitable hyper-parameters, the spike and slab bimodal method slightly outperforms the Bayesian lasso in the current analysis. Finally, a real example related to the China household finance survey is analyzed to illustrate the application of the methodology.. .

Expansion tube is ideal energy absorber which dissipates kinetic energy through plastic deformation and friction. There is an urgent need to understand the influence of key parameter, e.g. semi angle, tube material, and friction coefficient, on the mechanical response and energy absorption characteristics of expansion tube. In the present work, the material properties of the tubes were tested under quasi-static loading condition, and the numerical simulations were carried out by using commercial software ABAQUS. Based on the validated finite element simulation, all the semi angle, tube material, and friction have significant effects on the energy absorption capacity of expansion tube. The expansion tube with high tensile stress of parent material have high energy absorption capacity, while the specific energy absorption is linear with the tensile stress/density of tube material. This work would give a guidance to the structural design and parent materials selection for expansion tubes.

In this essay, the new notion concerning longest path is introduced. Longest path has a close relation with the notion of diameter in graph. The classes of graph are studied in the terms of having the vertex with longest path. Valued number is the number of edges belong to the longest path in the matter of vertex. For every vertex, there’s a valued number and new notion of valued set is the generalization of valued number for the vertex when all vertices of the graphs are corresponded to a vertex which has the greater valued number. For any positive integer, there’s one graph in that, there’s vertex which its valued number is that. By deleting the vertices which don’t belong to valued set, new notion of new graph is up. It’s called valued graph. The comparison amid valued graph and initial graph is up, too.

In this article, some notions about set, weight of set, number, number's position, special vertex are introduced. Some classes of graph under these new notions have been opted as if the study on the special attributes of these new notion when they've acted amid each other is considered. Internal and external relations amid these new notions have been obtained as if some classes of graphs in the matter of these notions are been pointed out.

This study aims to examine the non-volatile Particle Number (PN) emissions of a retrofitted Heavy-Duty Spark-Ignition (HD-SI) engine powered by liquefied petroleum gas (LPG) under both steady-state and transient conditions. The engine was tested under seven steady-state operating points to investigate the PN behavior and Particle Size Distribution (PSD) upstream and down-stream of the Three-Way Catalyst (TWC). This analysis intends to assess the impact of including particles with diameters ranging from 10 nm to 23 nm in the total particle count, a consideration for future regulations. The study employed the World Harmonized Transient Cycle (WHTC) for transient conditions to encompass the same engine working region used in the steady-state analysis. A Dekati FPS-4000 diluted the exhaust sample to measure the PSD and PN for particle diameters between 5.6 nm and 560 nm using the TSI-Engine Exhaust Particle Sizer (EEPS) 3090. Findings indicate that PN levels tend to increase downstream of the TWC under steady-state conditions in operating points with low exhaust gas temperatures and flows (equal to or less than 500 °C and 120 kg/h). Furthermore, the inclusion of particles with diameters between 10 nm and 23 nm leads to an increase in PN emissions by 17.70% to 40.84% under steady conditions and by an average of 40.06% under transient conditions, compared to measurements that only consider particles larger than 23 nm. Notably, in transient conditions, most PN emissions occur during the final 600 seconds of the cycle, linked to the most intense phase of the WHTC.

In the paper, the author introduces the notions "multi-order logarithmic numbers" and "multi-order logarithmic polynomials", establishes an explicit formula, an identity, and two recurrence relations by virtue of the Faa di Bruno formula and two identities of the Bell polynomials of the second kind in terms of the Stirling numbers of the fi rst and second kinds, and constructs some determinantal inequalities, product inequalities, logarithmic convexity for multi-order logarithmic numbers and polynomials by virtue of some properties of completely monotonic functions.

In the paper, the authors establish two identities to express the generating function of the Chebyshev polynomials of the second kind and its higher order derivatives in terms of the generating function and its derivatives each other, deduce an explicit formula and an identities for the Chebyshev polynomials of the second kind, derive the inverse of an integer, unit, and lower triangular matrix, present several identities of the Catalan numbers, and give some remarks on the closely related results including connections of the Catalan numbers respectively with the Chebyshev polynomials, the central Delannoy numbers, and the Fibonacci polynomials.

This paper studies the integrated design problems of control and guidance with parameter uncertainties, target disturbances, input constraints and actuator faults. Firstly, based on the integrated design idea of the missile guidance and control, the auxiliary variable is used to establish and transform it into a cascade system with input constraints, actuator faults and disturbances of unknown upper bounds. Secondly, the adaptive anti-saturation dynamic surface fault-tolerant controller is designed by using the back-stepping method, adaptive control, auxiliary system and tracking differentiator. By introducing the tracking differentiator and tangent barrier Lyapunov function, the computational explosion problem in the traditional back-stepping method is avoided and the angle of attack can be guaranteed in prospective range, respectively. Finally, the theoretical proof of the designed control strategy is given to ensure that the states of the closed-loop system are bounded. At the same time, the digital simulation of the maneuvering target of different maneuvering forms is carried out, which further illustrate the effectiveness and robustness of the designed control schemes.

Background: Constipation is one of the chronic gastrointestinal functional diseases that affects the quality of life. While Qi Lang Formula (QLF) has demonstrated effectiveness in alleviating constipation symptoms, its precise mechanism remains elusive. Methods: QLF was analyzed using UPLC-MS/MS. Targets for QLF were collected from SwissADME, Herb, ITCM databases, and FC-related targets from scRNA-seq and Genecards databases. Overlapping targets suggested potential QLF therapy targets for FC. Enrichment analysis used the KOBAS database. A "drug-ingredient-target" network was constructed with Cytoscape, and AutoDock verified active component binding. H&E staining assessed colonic mucosa changes, TEM examined ICC structural changes. ELISA measured neurotransmitter levels, and western blot verified QLF's effect on target proteins. ICC proliferation was observed through immunofluorescence. Results: We identified 89 targets of QLF associated with ICC-related FC, with c-Kit emerging as the pivotal target. Molecular docking studies revealed that Atractylenolide Ⅲ, Apigenin, Formononetin, Isorhamnetin, Naringenin, and Ononin exhibited strong binding affinities for the c-Kit structural domain. QLF significantly enhanced first stool passage time, fecal frequency, fecal moisture content, and intestinal propulsion rate. Further analysis unveiled that QLF not only restored neurotransmitter levels but also mitigated colon muscular fiber ruptures. ICC ultrastructure exhibited partial recovery, while RT-qPCR and western blot confirmed upregulated c-Kit expression and downstream targets. Immunofluorescence results indicated ICC proliferation post QLF treatment in rat colon. Conclusion: Our findings suggest that QLF may promote ICC proliferation by targeting SCF/c-Kit and its downstream signaling pathway, thereby regulating intestinal motility.

Lignin is insoluble in water, limiting its use in the synthesis of adhesives. Therefore, in order to increase the amount of lignin raw materials used in the synthesis of adhesives, a kind of aminated lignin compounds was prepared through lignin amination reaction, and conducting structural analysis in this paper. The particle size of the amino lignin is about 100 nm, with the weight average molecular weight of 57,627 g/mol and a water solubility of 0.45g/100ml. The reaction mechanisms were proposed that the phenolic hydroxyl groups of lignin react with ammonia molecules, and thereby successfully introducing amino groups to generate the aminated lignin compounds. Therefore, this article enriches the scientific theory of lignin reactions and provides reference for the widespread application of lignin raw materials in the field of adhesives.

In the paper, the author finds bounds of the sine and cosine along a circle on the complex plane in terms of two double inequalities for the norms of the sine and cosine along a circle on the complex plane.

Currently the rapid growth of global economy has the competition among high-tech industries develop from regional to global, and the competition becomes fierce. In face of such fierce competition in global high-tech industry, it is realized that tangible assets could no longer be the differentiation basis, but intangible assets are regarded as the differentiation capital. An enterprise with sustainable innovation would dominate the world market and enhance the international competitiveness of domestic economy. When internal entrepreneurial culture is prevalent, an enterprise would naturally promote the innovation capability. Such a point of view also explains more popular of the innovative products or services of some enterprises than those with larger scales. Aiming at employees in high-tech industry in Guanxi Province, total 500 copies of questionnaire are randomly distributed, and 337 valid copies are retrieved, with the retrieval rate 67%. The research results reveal significantly positive correlations between 1.entrepreneurial culture and sustainable innovation capability, 2.sustainable innovation capability and patent, and 3.entrepreneurial culture and patent. According to the results, suggestions are proposed, expecting to explain how a high-tech business outperforms in the changeable digital era and acquires the sustainable innovation capability and patent to grasp the opportunity.

In the paper, the author discusses and computes bounds of the sine and cosine along straight lines on the complex plane.

In the paper, by convolution theorem for the Laplace transforms and analytic techniques, the author finds necessary and sufficient conditions for complete monotonicity, monotonicity, and inequalities of several functions involving polygamma functions. By these results, the author derives a lower bound of a function related to the sectional curvature of the manifold of the beta distributions. Finally, the author poses several guesses and open problems related to monotonicity, complete monotonicity, and inequalities of several functions involving polygamma functions.

this paper we present approaches for generating random numbers along with potential applications. Rather than trying to provide extensive coverage of several techniques or algorithms that have appeared in the scientific literature, we focus on some representative approaches presenting their workings and properties in detail. Our goal is to delineate their strengths and weaknesses as well as their potential application domains so as the reader can judge what would be the best approach for the application in hand, possibly a combination of the available approaches. For instance, a physical source of randomness can be used for the initial seed, then suitable preprocessing can enhance its randomness and then the output of the preprocessing can feed different types of generators, e.g. a linear congruential generator, a cryptographically secure one and one based on the combination of one way hash functions and shared key cryptoalgorithms in various modes of operation. Then, if desired, the outputs of the different generators can be combined giving the final random sequence. Moreover, we present a set of practical randomness tests which can be applied on the outputs of random number generators in order to assess their randomness characteristics. In order to demonstrate the importance of unpredictable random sequences, we present an application of cryptographically secure generators in domains where unpredictability is one of the major requirements, i.e. eLotteries and cryptographic key generation.

Background: The effectiveness of the anti-COVID-19 vaccine remains a matter to be clarified. Methods: The humoral and cellular immunity after the administration of three doses of the Pfizer–BioNTech and Oxford AstraZeneca vaccines against SARS-CoV-2 over one year and the appearance of post-vaccination COVID-19 have been studied. Results: Anti-SARS-CoV-2 IgG and IgA antibodies showed a progressive increase throughout the vaccination period. This increase was greatest after the third dose. The highest levels were observed in subjects who had anti-SARS-CoV-2 antibodies prior to vaccination. There was an increase in CD4+ αβ, CD8+ γδ and TEM CD8+ γδ T cells, and a decrease in apoptosis in CD4+CD8+ and CD56+ αβ and γδ T cells. Post-vaccination SARS-CoV-2 infection was greater than 60%. The symptoms of COVID-19 were very mild and were related to γδ T cell deficit, specifically CD8+ TEMRA and CD56+ γδ TEM, as well as lower pre-vaccine apoptosis levels. Conclusions: Those results demonstrate the important role that γδ T cells play in SARS-CoV-2 vaccine immunization.

Elderly individuals frequently perceive companion robots devoid of warmth, resulting in a reluctance to accept these robots' services. This perception has become a significant barrier to the introduction of companion robots into households. To address this issue, this study employs KE methods to translate the elderly's need for warmth perception from companion robots into elements of modelling design. Initially, 20 pairs of affective words and 22 sample images of companion robots were chosen. The "rational-emotional" and "dim-bright" dimensions were identified as positively influencing the elderly's warmth perception of companion robots through SD method analysis. Subsequently, a hierarchical analysis table was established, with warmth perception as the root layer, modelling style and color matching as the basic layer, "rational-emotional" and "dim-bright" as the expansion layer, and the eight characteristic elements of companion robots as the morphological layer. The link between affective imagery and design elements was then established from the sample robots with higher warmth perception scores. Based on the correlation between the two, various design schemes were formed through random combinations. Finally, the design schemes were evaluated using the warmth perception scale, and the warmth perception scores of each sample model were obtained. This research provides design references for designing companion robots for the elderly with a "sense of warmth".

Over the past decades, overweight and obesity has become a global epidemic and the leading threat for death. To prevent the serious risk, an overweight or obese individual must apply a long-term weight-management strategy to control food intake and physical activities, which is however, not easy. Recently, with the advances of information technology, more and more people can use wearable devices and smartphones to obtain physical activity information, while they can also access various health-related information from Internet online social networks (OSNs). Nevertheless, there is a lack of an integrated approach that can combine these two methods in an efficient way. In this paper, we address this issue and propose a novel mobile-social framework for health recognition and recommendation, namely, H-Rec². The main ideas of H-Rec² include (1) to recognize the individual's health status using smartphone as a general platform, and (2) to recommend physical activity and food intake based on personal health information, life science principles, and health-related information obtained from OSNs. To demonstrate the potentials of the H-Rec² framework, we develop a prototype that consists of four important components: (1) an activity recognition module that senses physical activity using accelerometer, (2) a health status modeling module that applies a novel algorithm to generate personalized health status index, (3) a restaurant information collection module that collects relevant information from OSN, and (4) a restaurant recommendation module that provides personalized and context-aware recommendation. To evaluate the prototype, we conduct both objective and subjective experiments, which confirm the performance and effectiveness of the proposed system.

Tack is one of the most important factors affecting the operability of prepregs, but it is still very difficult to obtain the change of prepreg tack with time at different temperatures. In this paper, a newly designed T-peel device is used to test the tack decay rate of prepregs at different temperatures. The obtained decay rate deviates less than 8.9% from the manufacturer's data. The maximum deviation of the ratio of tack decay speeds calculated by the Arrhenius equation from the experiments is not higher than -9.7%. It is proved that the present method can obtain the decay rate of tack of prepregs at different temperatures. This method is also applicable to the other two types of prepregs. The article proposes the handling life unit, an operational life measurement unit for prepregs, and establishes that the relationship between tack and remaining shelf life reduces prepreg management costs.

In this paper, we suggest an expansion of the Planck distribution function derived from the Boltzmann principle. Thereby, we consider expanding Planck's law with a new distribution function, and discuss fine structure constant. Furthermore, using ideas applied to the expansion of the Planck distribution function, we show that Von Koch's inequality can be derived without using the Riemann Hypothesis, that is, the Riemann Hypothesis is true, and that the abc conjecture is not true. Furthermore, we define a generalization of Entropy and discuss that Entropy is relevant to dynamical systems described by logistic function models, such as the growth of bacteria and populations.

In this outlet, I’ve devised the concept of relation amid two points where these points are coming up to make situation which in that the set of objects are greed to represent the story of how to be in whatever situations when these two points have the styles of being everywhere in the highlights of the concept which are coming from the merits of these points where are eligible to make capable situation to overcome every situation when they’re participant in the hugely diverse situations which mean too styles of graphs with have the name or the general results for the general situation as possible as are.

In the paper, the authors survey integral representations (including the Lévy--Khintchine representations) and applications of some bivariate means (including the logarithmic mean, the identric mean, Stolarsky's mean, the harmonic mean, the (weighted) geometric means and their reciprocals, and the Toader--Qi mean) and the multivariate (weighted) geometric means and their reciprocals, derive integral representations of bivariate complex geometric mean and its reciprocal, and apply these newly-derived integral representations to establish integral representations of Heronian mean of power 2 and its reciprocal.

Extensive genome structure variation, such as copy number variations (CNVs) and presence/absence variations, is the basis for the remarkable maize genetic diversity; however, the effect of CNVs on maize herbivory defense remains largely underexplored. Here, we report that the naturally occurring duplication of the maize 9-lipoxygenase gene, ZmLOX5, leads to increased resistance of maize to herbivory by fall armyworms (FAW). Previously, we showed that ZmLOX5-derived oxylipins are required for defense against chewing insect herbivores and identified several inbred lines, including Yu796, that contained duplicated CNVs of ZmLOX5, referred to as Yu796-2×LOX5. To test whether introgression of the Yu796-2×LOX5 locus into the herbivore-susceptible B73 background that contains a single ZmLOX5 gene is a feasible approach to increase resistance, we generated a series of near-isogenic lines that contained either 2, 1 or 0 copies of the Yu796-2×LOX5 locus in the B73 background by six back crosses (BC6). Droplet digital PCR (ddPCR) confirmed the successful introgression of the Yu796-2×LOX5 locus in B73. The resulting B73-2×LOX5 inbred line displayed increased resistance against FAW associated with increased expression of ZmLOX5, increased wound-induced production of its primary oxylipin product, the α-ketol, 9-hydroxy-10-oxo-12(Z),15(Z)-octadecadienoic acid (9,10-KODA), and the downstream defense hormones regulated by this molecule, 12-oxo-phytodienoic acid (12-OPDA) and abscisic acid (ABA). Surprisingly, wound-induced JA-Ile production was not increased in B73-2×LOX5, resulting from the increased JA catabolism. Furthermore, B73-2×LOX5 displayed enhanced drought tolerance likely due to increased ABA and 12-OPDA content. Taken together, this study revealed that the duplicated CNV of ZmLOX5 quantitively contributes to maize antiherbivore defense and presents proof-of-concept evidence that the introgression of naturally occurring duplicated CNVs of a defensive gene into the productive, but susceptible, crop varieties is a feasible breeding approach for enhancing plant resistance to herbivory and tolerance to abiotic stress.

The main purpose of this paper is to present a comprehensive view of the application mathematical models in the designing and implementing SSCM beside to solving problems and making decision. The research questions are: what mathematical models are used for designing and implementing sustainable supply chain management, how to use them, which industries implemented in, what modules of SSCM depth in and finally finding the gaps of researches. The methodology of research is Systematic Literature review through peer review papers which are published in high ranking journals. In this paper, First, we search all papers through scientific data bases like Scopus, science direct, MDPI, Springer, Google Scholar, then, screening papers based on the criteria such as subject of paper, journals impact factor which is published in-should be peer review journal- and relative content of the papers. Finally, we selected 245 papers with three steps screening through 2806 papers that they have enough quality and relative to our research goals for context analysis. Through context analysis, first we categorized the information of the papers and drew the current situation of researches in the framework of our topic. Then, we evaluate and compare the goals of sustainability and current situation and found the gapes, then, offered new suggestions like implementing SSCMs models in pollutant industries like casting industry, Heavy industry, coal Industry and so on. On the other hand, there are gaps in researches in some modules of SSCM such as packaging, designing products, etc.

In recent years, many algorithms based on end-to-end deep networks have been proposed to deal with the target detection problem of videos. However, the deep network models usually consume a lot of computing resources during the procedure of analysis of videos with complex dynamic backgrounds. In this paper, a new method of object detection based on information theory is presented. Firstly, each frame in a video is converted into an effective information map by using the Harris corner detection method. Secondly, the sensitive areas in the frame are extracted by using the context information and the effective information maps of the consecutive video frames. The sensitive areas in the video frame are the candidate areas where the target objects would be appeared at high probabilities. Thirdly, the information entropy features of each sensitive area are extracted to form the feature matrix, based on which, an SVM model is trained for selecting the target areas from the sensitive areas. Finally, the locations of the objects are detected based on the target areas in the video with a complex dynamic background. As a lightweight video detection framework, the method presented in this paper can save a lot of computing resources. Experimental results show that this method can achieve good results in the benchmark of CDnet 2014.

For better solving both fuzziness and reliability occurring in practical issues simultaneously, Z-number deserves further exploration under uncertainty environment. Based on the credibility distribution and conversion rules, we define its expected value, variance, and semi-variance, and realize the feasibility of calculation by deriving calculation formulas. Moreover, we delve into three characteristics inherent in symmetrical Z-numbers. The link that followed between the variance and the semi-variance of Z-numbers is discovered and proved. Furthermore, we apply the formulas of expected value and variance on Z-numbers to examples, whose consequences validate our proposed formulas. The findings indicate the significance of our study in applying the expected value and variance of fuzzy sets across diverse fields.

In the paper, the authors find two explicit formulas and recover a recursive formula for the generalized Motzkin numbers. Consequently, the authors deduce two explicit formulas and a recursive formula for the Motzkin numbers, the Catalan numbers, and the restricted hexagonal numbers respectively.

In the paper, by virtue of convolution theorem for the Laplace transforms, Bernstein's theorem for completely monotonic functions, and other techniques, the author finds necessary and sufficient conditions for a difference constituted by four derivatives of a function involving trigamma function to be completely monotonic.

In the paper, by induction and recursively, the author proves that the generating function of multivariate logarithmic polynomials and its reciprocal are a Bernstein function and a completely monotonic function respectively, establishes a Lévy-Khintchine representation for the generating function of multivariate logarithmic polynomials, deduces an integral representation for multivariate logarithmic polynomials, presents an integral representation for the reciprocal of the generating function of multivariate logarithmic polynomials, computes real and imaginary parts for the generating function of multivariate logarithmic polynomials, derives two integral formulas, and denies the uniform convergence of a known integral representation for Bernstein functions.

In the paper, by virtue of some properties for the Riemann zeta function, the author finds a double inequality for the ratio of two consecutive Bernoulli numbers with even indexes and analyzes the approximating accuracy of the double inequality.

In the paper, the author (1) presents an explicit formula and its inversion formula for higher order derivatives of generating functions of the Bell polynomials, with the help of the Faà di Bruno formula, properties of the Bell polynomials of the second kind, and the inversion theorem for the Stirling numbers of the first and second kinds; (2) recovers an explicit formula and its inversion formula for the Bell polynomials in terms of the Stirling numbers of the first and second kinds, with the aid of the above explicit formula and its inversion formula for higher order derivatives of generating functions of the Bell polynomials; (3) constructs some determinantal and product inequalities and deduces the logarithmic convexity of the Bell polynomials, with the assistance of the complete monotonicity of generating functions of the Bell polynomials. These inequalities are main results of the paper.

The Goldbach's conjecture has been described as the most difficult problem in the history of Mathematics. This conjecture states that every even integer greater than 2 can be written as the sum of two primes. This is known as the strong Goldbach's conjecture. The conjecture that all odd numbers greater than 7 are the sum of three odd primes is known today as the weak Goldbach conjecture. A principal complexity class is NSPACE(S(n)) for some S(n). We show if the weak Goldbach's conjecture is true, then the problem PRIMES is not in NSPACE(S(n)) for all S(n) = o(log n). This proof is based on the assumption that if some language belongs to NSPACE(S(n)), then the unary version of that language belongs to NSPACE(S(log n)) and vice versa. However, if PRIMES is not in NSPACE(S(n)) for all S(n) = o(log n), then the strong Goldbach's conjecture is true or this has an infinite number of counterexamples. Since Harald Helfgott proved that the weak Goldbach's conjecture is true, then the strong Goldbach's conjecture is true or this has an infinite number of counterexamples, where the case of infinite number of counterexamples statistically seems to be unlikely. In addition, if PRIMES is not in NSPACE(S(n)) for all S(n) = o(log n), then the Twin prime conjecture is true. Moreover, if PRIMES is not in NSPACE(S(n)) for all S(n) = o(log n), then the Beal's conjecture is true. Since the Beal's conjecture is a generalization of Fermat's Last Theorem, then this is also a simple and short proof for that Theorem. In mathematics, the Riemann hypothesis is consider to be the most important unsolved problem in pure mathematics. If PRIMES is not in NSPACE(S(n)) for all S(n) = o(log n), then the Riemann hypothesis is true.

The three-phase separator was perforated after four years’ service. The perforation position is at the bottom of the vessel under the baffle plate in an oil transfer station. The cause of perforation was investigated by chemical analysis using a direct-reading spectrometer, microstructure examined by optical microscope(OM), and lab simulated corrosion experiments by electrochemical workstation, and the corrosion products examined with scanning electron microscopy(SEM), energy dispersive spectrometer(EDS) in this paper. The analyses indicated that the coating at the base of the pressure vessel failed and this led to the direct exposure of the carbon steel plate to the corrosive medium. The electrical contact between the carbon steel and the stainless steel, sets up a galvanic cell that accelerated the corrosion of the pressure vessel which eventually led leads to the perforation.

With the advancement of the economy and society, policymakers acknowledge the significance of improving rural households' well-being as a crucial factor in promoting sustainable economic and social development. Based on the matching data of China Household Finance Survey and Digital Rural County Index, this study empirically examines the effect and mechanisms of digital village construction on subjective well-being of rural households. The results revealed that digital village construction has a significant improvement in their subjective well-being. The impact of digital village construction is particularly significant in rural areas located in the western regions of China, as well as among households possessing higher levels of human capital. The process through which digital village construction enhances the subjective well-being of rural households involves the augmentation of household income, the promotion of non-farm employment opportunities, and the enhancement of rural governance. This study provides robust micro-empirical evidence highlighting the positive welfare effects of digital rural construction. This study provides insights into the digital village construction within the happiness economy framework, offering a new perspective. The imperative to strengthen rural digital infrastructure and improve farmers' proficiency in modern information skills is a strategic policy aimed at enhancing well-being of rural households.

A Mw7.8 earthquake struck Turkey on February 6, 2023, causing severe casualties and economic losses. This paper investigates the characteristics of strong ground motion and seismogenic fault of the earthquake. We collected and processed the strong ground motion records of 379 stations using Matlab, SeismoSignal and Surfer software, and obtained the peak ground acceleration (PGA) contour map. We analyzed the near-fault effect, the fault locking segment effect and the trampoline effect of the earthquake based on the spatial distribution of PGA, the fault geometry and slip distribution. We found that the earthquake generated a very strong ground motion concentration effect in the near-fault area, with the maximum PGA exceeding 2000cm/s2. However, the presence of fault locking segments influenced the spatial distribution of ground motion, resulting in four significant PGA high-value concentration areas at a local dislocation, a turning point and the end of the East Anatolian Fault. We also revealed for the first time the typical manifestation of the trampoline effect in this earthquake, which was characterized by a large vertical acceleration with the positive direction significantly larger than the negative direction. This paper provides an important reference for understanding the seismogenic mechanism, damage mode, characteristics and strong earthquake law of Turkey earthquake.

Anthocyanins extract from purple tomato (PTA) was incorporated with polyvinyl alcohol (PVA) so that a series of colorimetric films of PVA/PTA (based on PVA) were prepared. The role of anthocyanin on color response, FTIR, thickness, water content, mechanical properties, antioxidant activity, and permeation of water vapor through the films was examined. In addition, its application in smart packaging to assess the freshness of shrimp was studied. It was found that the tensile strength, contact angle and WVP of PVA/PTA films increases with the addition of more PTA, while the elongation at break and water content decreased. FTIR analysis showed that there are interactions between PTA and PVA matrix. The addition of anthocyanins caused to a significant improvement for the antioxidant properties of PVA films. Furthermore, the total volatile alkaline nitrogen (TVB-N), total plate count (TPC) and pH value of shrimp were monitored after 4 days of refrigeration, and the color change of the indexes was recorded. The PVA/PTA films changed color from purple to yellow-green during the storage time of 0-4d for shrimp, this suggests that the film could be used in smart packaging as a real-time freshness indicator for shrimp.

A number of chemical modifications were carried out in order to synthesize new compounds based on the triterpenoid betulonic acid. Triazolation reactions were carried out for the synthesis of new 1,2,3-triazole derivatives based on betulonic acid. Chemical changes were made on the carbonyl group at the C-3 position of the initial molecule and on the carboxyl and hydroxyl groups at the C-28 position. Chromatographic methods were used to separate and purify the formed products. Spectroscopic (NMR-, mass-) methods were used to establish the structure of synthesized compounds. As a result of the chemical transformations carried out, a number of new derivatives of betulonic acid were obtained. All synthesized compounds were tested for antimicrobial and cytotoxic activity. As a result, compounds with pronounced antimicrobial activity were identified.

YOLOv8, as an efficient object detection method, can swiftly and precisely identify objects within images. However, traditional algorithms encounter difficulties when detecting small targets in remote sensing images, such as missing information, background noise, and interactions among multiple objects in complex scenes, which may affect performance. To tackle these challenges, we propose an enhanced algorithm optimized for detecting small objects in remote sensing images, named HP-YOLOv8. Firstly, we design the C2f-D-Mixer (C2f-DM) module as a replacement for the original C2f module. This module integrates both local and global information, significantly improving the ability to detect features of small objects. Secondly, we introduce a feature fusion technique based on attention mechanisms, named Bi-Level Routing Attention in Gated Feature Pyramid Network (BGFPN). This technique utilizes an efficient feature aggregation network and reparameterization technology to optimize information interaction between different scale feature maps, and through the Bi-level Routing Attention (BRA) mechanism, it effectively captures critical feature information of small target objects. Finally, we propose the Smooth Mean Perpendicular Distance Intersection over Union (SMPDIoU) loss function. The method comprehensively considers the shape and size of detection boxes, enhances the model's focus on the attributes of detection boxes and provides a more accurate bounding box regression loss calculation method. To demonstrate our approach's efficacy, we conduct comprehensive experiments across the RSOD, NWPU VHR-10, and VisDrone2019 datasets. The experimental results show that the HP-YOLOv8 achieves 95.11%, 93.05%, and 53.49% in the [email protected] metric, and 72.03%, 65.37%, and 38.91% in the more stringent [email protected]:0.95 metric, respectively.

In this work, we try to find a way to describe the physical law of micro-world under the frame of a space-time theory. By introducing the scalar fields $\mathcal{D}\left( x\right)$ and $\zeta\left( x\right) $, we rewrite the action of conventional field theory and the Lagrangian describing the motion of the particle, where a modified space-time relation is obtained. To test the correctness of this attempt, we demonstrate the Klein-Gordon equation by the Hamilton-Jacobi method in four dimensional form and present a time delay for the ground state of hydrogen atom.

In vertical coordinates, (x,y,z), the gradient Richardson number Ri=N^2⁄S^2 is the square of the ratio between buoyancy frequency N and vertical-shear amplitude S, where N^2=-(g⁄ρ) ∂ρ⁄∂z and S^2=(∂u⁄∂z)^2+ (∂v⁄∂z)^2, with ρ potential density, (u,v) the horizontal velocity components and g gravity acceleration, so that a decrease in stratification brings a decrease in dynamic stability and vice versa. In the isopycnic coordinate system, (x,y,ρ), however, Ri=M^2⁄〖S_ρ〗^2 , is the ratio between 〖M^2≡N〗^(-2) and the squared diapycnal shear 〖S_ρ〗^2=(ρ⁄g)^2 [(∂u⁄∂ρ)^2+ (∂v⁄∂ρ)^2 ], so a decrease in stratification leads to an increase in dynamic stability and vice versa. The apparently different role of stratification arises because S and S_ρ are related through the stratification itself, S_ρ=S⁄N^2 or, equivalently, τ=〖t_o〗^2⁄t_d , which is interpreted as a natural oscillation time τ≡S_ρ that equals the buoyancy or oscillation time t_o=N^(-1) normalized by the ratio t_o⁄t_d , where the deformation time is t_d=S^(-1). Here we follow simple arguments and use field data from three different situations (island shelf-break, Gulf Stream and Mediterranean outflow) to endorse the usefulness of the isopycnal approach. In particular, we define the reduced squared vertical σ^2= S^2-N^2 and reduced squared diapycnal shear 〖σ_ρ〗^2= 〖S_ρ〗^2-M^2, which are positive for unstable conditions and negative for stable conditions. It turns out that Ri and σ^2 remain highly variable for all stratification conditions; in contrast, the mean 〖σ_ρ〗^2 values display a univocal tendency, its magnitude decreasing with stratification. We propose 〖σ_ρ〗^2 and 〖S_ρ〗^2 to be good indexes for the occurrence of effective mixing under high stratification conditions.

The UNUSUAL FLORAL ORGANS (UFO) gene is an essential regulatory factor of class B genes and plays a vital role in the process of inflorescence primordial and flower primordial development. We investigated the role of UFO genes in soybean to better understand the development of floral organs through gene cloning, expression analysis, and gene knockout. In situ hybridization demonstrated predominant expression of the GmUFO1 gene in the flower primordium. Phenotypic observation of GmUFO1 knockout mutant lines (Gmufo1) showed obvious alteration in floral organ number and shape, and mosaic organ formation. In contrast, GmUFO2 knockout mutant lines (Gmufo2) showed no obvious difference in floral organs. However, the GmUFO1 and GmUFO2 double knockout lines (Gmufo1ufo2) showed a more severe mutant phenotype than the Gmufo1 lines. Gene expression analysis also showed differences in the expression of major ABC function genes in the knockout lines. Based on the phenotypic and expression analysis, our results suggest the major role of GmUFO1 in the regulation of flower organ formation in soybean and that GmUFO2 does not have any direct effect, but it might have an interaction role with GmUFO1 in the regulation of flower development. In conclusion, the present study identified UFO genes in soybean and improved our understanding of floral development that could be useful for flower design in hybrid soybean breeding.

In this paper, we introduce hybrid numbers with Fibonacci and Lucas hybrid number coefficients. We give the Binet formulas, generating functions, exponential generating functions for these numbers. Then we define an associate matrix for these numbers. In addition, using this matrix, we present two different versions of Cassini identitiy of these numbers.

The challenging terrain and deep ravines characteristic of mountainous regions often result in slower path planning and suboptimal flight paths for Unmanned Aerial Vehicles (UAVs) when traditional meta-heuristic optimization algorithms are employed. This study investigates the application of an Improved Enhanced Snake Optimizer (IESO) for three-dimensional path planning in a simulated rugged mountainous terrain. The initialization process in the enhanced snake optimizer is refined by integrating the Chebyshev chaotic map. Additionally, a non-monotonic factor is introduced to modulate the "temperature," and a boundary condition is incorporated into the dynamic opposition learning mechanism. These modifications collectively reduce the likelihood of population convergence to local optima during optimization. The feasibility of IESO is validated through time complexity and global convergence analyses. Comparative simulation experiments benchmarked IESO against five state-of-the-art optimization algorithms across test functions and path-planning simulated scenarios. The experimental results indicate that the enhanced algorithm achieves superior optimization precision, faster convergence speeds, and improved quality in the planned trajectories by 30%.

In modern warfare, the diversified tasks can sometimes be challenging to fulfill with a single projectile, necessitating the incorporation of cooperation constraints in trajectory planning. Limited by the stringent requirements of the launch platform and lower costs, the maneuverability and ability to adjust the flight time range of projectiles are weak. Therefore, the rationality of performance indicators and flight time coordination strategies is especially critical. To fully exploit the control capabilities of projectiles, a battlefield area segmentation method is proposed, differentiated performance indicators and a cooperative trajectory planning model that considers the entire range of projectiles are established. Considering the limitations of existing flight time coordination strategies in applications, targeted improvements have been made in different cooperation scenarios, and a bi-level adaptive cooperation strategy(BACS) with both optimality and flexibility is proposed. To rapidly determine feasible conditions, a simple and universal method for obtaining the capability ranges of cooperation is introduced. The multi-phase optimal control problems are transformed into nonlinear programming problems using the Radau pseudo-spectral method, and simulation results show that the proposed methods are capable of handling trajectory planning tasks in different cooperation scenarios. The improved strategies effectively enhance the planning success rate under relatively harsh conditions and BACS demonstrates good compatibility with the problems studied.

Due to constraints in launch platform and cost, the maneuverability of gliding-guided projectiles is limited, necessitating a rational design of their trajectory schemes. To reduce the sensitivity of trajectory schemes to uncertainties while ensuring compatibility between flight schemes and guidance control systems, and fully exploiting the control capability of the projectile, a closed-loop robust trajectory planning method is proposed. Models of major uncertain factors and states deviation at the control-start point are established. Based on the NIPCE method, the stochastic dynamic model is transformed into a high-dimensional deterministic model with PCE coefficients as state variables, and the uncertainty propagation law is obtained. A PID algorithm is employed to design a tracking guidance law based on position error feedback, and open-loop and closed-loop robust trajectory planning models are established accordingly. The optimal control problem is solved by transforming it into a nonlinear programming problem using the direct shooting method. Simulation results indicate that the NIPCE method can significantly improve the computational efficiency of uncertainty propagation while ensuring accuracy. Open-loop robust planning can effectively mitigate the sensitivity of gliding trajectories to uncertainties but cannot completely eliminate terminal dispersion. Closed-loop robust planning effectively improves control effort consumption on the basis of open-loop planning.

New setting is introduced to study neutrosophic failed-independent number and failed independent neutrosophic-number arising neighborhood of different vertices. Neighbor is a key term to have these notions. Having all possible edges amid vertices in a set is a key type of approach to have these notions namely neutrosophic failed-independent number and failed independent neutrosophic-number. Two numbers are obtained but now both settings leads to approach is on demand which is finding biggest set which have all vertices which are neighbors. Let NTG : (V,E,σ,μ) be a neutrosophic graph. Then failed independent number I(NTG) for a neutrosophic graph NTG : (V,E,σ,μ) is maximum cardinality of a set S of vertices such that every two vertices of S are endpoints for an edge, simultaneously; failed independent neutrosophic-number In(NTG) for a neutrosophic graph NTG : (V,E,σ,μ) is maximum neutrosophic cardinality of a set S of vertices such that every two vertices of S are endpoints for an edge, simultaneously. As concluding results, there are some statements, remarks, examples and clarifications about some classes of neutrosophic graphs namely path-neutrosophic graphs, cycle-neutrosophic graphs, complete-neutrosophic graphs, star-neutrosophic graphs, complete-bipartite-neutrosophic graphs and complete-t-partite-neutrosophic graphs. The clarifications are also presented in both sections “Setting of Neutrosophic Failed-Independent Number,” and “Setting of Failed Independent Neutrosophic-Number,” for introduced results and used classes. Neutrosophic number is reused in this way. It’s applied to use the type of neutrosophic number in the way that, three values of a vertex are used and they’ve same share to construct this number to compare with other vertices. Summation of three values of vertex makes one number and applying it to a comparison. This approach facilitates identifying vertices which form neutrosophic failed-independent number and failed independent neutrosophic-number arising neighborhoods of vertices. In path-neutrosophic graphs, two neighbors, form maximal set but with slightly differences, in cycle-neutrosophic graphs, two neighbors forms maximal set. Other classes have same approaches. In complete-neutrosophic graphs, a set of all vertices leads us to neutrosophic failed-independent number and failed independent neutrosophic-number. In star-neutrosophic graphs, a set of vertices containing only center and one other vertex, makes maximal set. In complete-bipartite-neutrosophic graphs, a set of vertices including two vertices from different parts makes intended set but with slightly differences, in complete-t-partite-neutrosophic graphs, a set of t vertices from different parts makes intended set. In both settings, some classes of well-known neutrosophic graphs are studied. Some clarifications for each result and each definition are provided. Using basic set to extend this set to set of all vertices has key role to have these notions in the form of neutrosophic failed-independent number and failed independent neutrosophic-number arising neighborhood of vertices. The cardinality of a set has eligibility to neutrosophic failed-independent number but the neutrosophic cardinality of a set has eligibility to call failed independent neutrosophic-number. Some results get more frameworks and perspective about these definitions. The way in that, two vertices have connections amid each other, opens the way to do some approaches. A vertex could affect on other vertex but there’s no usage of edges. These notions are applied into neutrosophic graphs as individuals but not family of them as drawbacks for these notions. Finding special neutrosophic graphs which are well-known, is an open way to pursue this study. Some problems are proposed to pursue this study. Basic familiarities with graph theory and neutrosophic graph theory are proposed for this article.

New setting is introduced to study chromatic number. Different types of chromatic numbers and neutrosophic chromatic number are proposed in this way, some results are obtained. Classes of neutrosophic graphs are used to obtains these numbers and the representatives of the colors. Using colors to assign to the vertices of neutrosophic graphs is applied. Some questions and problems are posed concerning ways to do further studies on this topic. Using different types of edges from connectedness in same neutrosophic graphs and in modified neutrosophic graphs to define the relation amid vertices which implies having different colors amid them and as consequences, choosing one vertex as a representative of each color to use them in a set of representatives and finally, using neutrosophic cardinality of this set to compute types of chromatic numbers. This specific relation amid edges is necessary to compute both types of chromatic number concerning the number of representative in the set of representatives and types of neutrosophic chromatic number concerning neutrosophic cardinality of set of representatives. If two vertices have no intended edge, then they can be assigned to same color even they’ve common edge. Basic familiarities with neutrosophic graph theory and graph theory are proposed for this article.

New setting is introduced to study chromatic number. vital chromatic number and n-vital chromatic number are proposed in this way, some results are obtained. Classes of neutrosophic graphs are used to obtains these numbers and the representatives of the colors. Using colors to assign to the vertices of neutrosophic graphs is applied. Some questions and problems are posed concerning ways to do further studies on this topic. Using vital edge from connectedness to define the relation amid vertices which implies having different colors amid them and as consequences, choosing one vertex as a representative of each color to use them in a set of representatives and finally, using neutrosophic cardinality of this set to compute vital chromatic number. This specific relation amid edges is necessary to compute both vital chromatic number concerning the number of representative in the set of representatives and n-vital chromatic number concerning neutrosophic cardinality of set of representatives. If two vertices have no vital edge, then they can be assigned to same color even they’ve common edge. Basic familiarities with neutrosophic graph theory and graph theory are proposed for this article.

Using machine learning or deep learning to solve the problem of garbage recognition and classification is an important application in computer vision, but due to the incomplete establishment of garbage datasets and the poor performance of complex network models on smart terminal devices, the existing garbage classification models The effect is not good.This paper presents a waste classification and identification method base on transfer learning and lightweight neural network. By migrating the lightweight neural network MobileNetV2 and rebuild it, The reconstructed network is used for feature extraction, and the extracted features are introduced into the SVM to realize the identification of 6 types of garbage. The model was trained and verified by using 2527 pieces of garbage labeled data in the TrashNet dataset, which ultimately resulted in a classification accuracy of 98.4% of the method, which proves that the method can effectively improve the classification accuracy and time and overcome the problem of weak data and less labeling. The over-fitting phenomenon encountered by small data sets in deep learning makes the model robust.

Saliency detection in synthetic aperture radar (SAR) image is a difficult problem. This paper proposed a multitask saliency detection (MSD) model for the saliency detection task of SAR image. Firstly, we extract four features of SAR image as the input of the MSD model, which include the intensity, orientation, uniqueness and global contrast. Then, the saliency map is generated by the multitask sparsity pursuit (MTSP) which integrates the multiple features collaboratively. Subjective and objective evaluation of the MSD model verifies its effectiveness. Based on the saliency maps of the source images, an image fusion method is proposed for the SAR and color optical image fusion. The experimental results of real data show the proposed image fusion method is superior to the presenting methods in terms of several universal quality evaluation indexes, as well as in the visual quality. The salient areas in the SAR image can be highlighted and the spatial and spectral details of color optical image can also be preserved in the fusion result.

The limited understanding of how digital platforms, especially the Metaverse, influence public perception and attitude towards sustainable fashion in large scaled markets such as China highlights a critical gap. This study aims to examine the perspectives and perception of the Chinese public regarding sustainable fashion in the Metaverse. Through content analysis, this study evaluated 3,889 Weibo posts from Shanghai Fashion Week 2024 to identify key sentiments and discussions on sustainable and digital fashion. Results indicate that 76.08% of the conversations centered on sustainable fashion, reflecting strong public commitment to environmental issues. The findings highlight characteristics of public perception towards the utilization of immersive technologies and underscore the Metaverse's potential as a platform for fostering environmental consciousness in the fashion industry. This research provides crucial insights for fashion brands looking to integrate sustainability into their digital strategies, addressing a significant gap in current literature and offering practical guidance for leveraging digital platforms to promote sustainable consumption.

Pneumonia remains a major cause of morbidity and mortality worldwide, especially during COVID-19 pandemic. With the significant global health burden that pneumonia poses, it is es-sential to improve therapeutic and management strategies. The increasing emergence of antibiotic resistant bacterial strains limits options for effective antibiotic use. New antibiotics for treatment of pneumonia may address deficits in current antimicrobial drugs, with an ability to cover both typical, atypical, and resistance pathogen. Several of these newer drugs also have structural characteristics that allow for a decreased propensity in development of bacterial resistance. Po-tential use of stem cell therapies in place of corticosteroid treatments may also offer an im-provement in patient outcomes. Human mesenchymal stem cell treatments have shown efficacy and safety in treating COVID-19 induced pneumonia. Combined treatment with both stem cells and antibiotics in pneumonia in a rabbit model has also shown significantly increased efficacy in comparison to antibiotic treatment alone, presenting yet another possible route for a novel strategy in treating pneumonia, though additional future studies are necessary before clinical implementation. While pneumonia remains a major disease of concern, having newer approved antibiotics as well as novel therapies such as stem cell treatments in the pipeline offers clinicians more options in effectively treating pneumonia.

It is well established the complex exponential and logarithm are multivalued functions, both failing to maintain most identities originally valid over the positive integers domain. Moreover the general case of complex logarithm, with a complex base, is hardly mentionned in mathematic litterature. We study the exponentiation and logarithm as binary operations where all operands are complex. In a redefined complex number system using an extension of the C field, hereafter named E, we prove both operations always produce single value results and maintain the validity of identities such as log_u (w v) = log_u (w) + log_u (v) where u, v, w in E. There is a cost as some algebraic properties of the addition and subtraction will be diminished, though remaining valid to a certain extent. In order to handle formulas in a C and E dual number system, we introduce the notion of set precision and set truncation. We show complex numbers as defined in C are insufficiently precise to grasp all subtleties of some complex operations, as a result multivaluation, identity failures and, in specific cases, wrong results are obtained when computing exclusively in C. A geometric representation of the new complex number system is proposed, in which the complex plane appears as an orthogonal projection, and where the complex logarithm and exponentiation can be simply represented. Finally we attempt an algebraic formalization of E.

Deep learning has achieved remarkable success in diverse computer science applications, however, its use in other traditional engineering fields has emerged only recently. In this project, we solved several mechanics problems governed by differential equations, using physics informed neural networks (PINN). The PINN embeds the differential equations into the loss of the neural network using automatic differentiation. We present our developments in the context of solving two main classes of problems: data-driven solutions and data-driven discoveries, and we compare the results with either analytical solutions or numerical solutions using the finite element method. The remarkable achievements of the PINN model shown in this report suggest the bright prospect of the physics-informed surrogate models that are fully differentiable with respect to all input coordinates and free parameters. More broadly, this study shows that PINN provides an attractive alternative to solve traditional engineering problems.

In the paper, the authors establish two identities, which can be regarded as nonlinear differential equations, for the generating function of Eulerian polynomials, find two identities for the Stirling numbers of the second kind, and present two identities for Eulerian polynomials and higher order Eulerian polynomials, pose two open problems about summability of two finite sums involving the Stirling numbers of the second kind. Some of these conclusions meaningfully and significantly simplify several known results.

Rollover prevention of partially-filled tank trucks is an industry teaser, with the core challenge being real-time perception and observation of the liquid state inside the tank. In order realize re-liable observation of sloshing liquid, this article firstly proposes a sloshing modeling method based on multi-degree-of-freedom pendulum model, and derives the double mass trammel pendulum model (DMTP, 2DOF) accordingly, which accurately reflects the sloshing dynamics under more pervasive working conditions. Secondly, a free surface fluctuation sensor is designed based on magnetostriction, capable of measuring the inclination and height of the liquid level inside tanks filled with hazardous chemical. Finally, the unscented Kalman filter (UKF) is utilized to synthesize the information of the two, establishing a credible real-time observation of the sloshing liquid. Verified through vehicle-fluid coupled co-simulation, under condition of con-secutive double lane change, observation error of the proposed method is only 25.9% that of the open-loop calculation, providing a secure guarantee for the observation of the state variables of the single pendulum model (SP) used for most kinds of anti-rollover controller.

Objective: To sort out the research hotspots of the application of VR in rehabilitation medicine, analyse its research themes and research trends, and offer a reference for future related research in this field. Methods: This paper provides an in-depth analysis of the development process, research hotspots and research trends in the field of VR application in rehabilitation medicine research, taking the Web of Science core dataset as the source and using bibliometric analysis by CiteSpace. Results: The application of VR in rehabilitation medicine was composed of three stages, and the research topics were reviewed in five aspects: neurological rehabilitation, psychology treatment, pain distraction, cardiopulmonary rehabilitation, and visual spatial disorder. Limitations: The literature data only come from the Web of Science core dataset, and the data sample size was not comprehensive. Conclusion: Overcoming VR technology-induced vertigo and mental disorders from overuse of VR are both challenges to research on the application of VR in rehabilitation medicine. In addition, developing VR products with better experience, developing standardized guidelines, and conducting more high-quality clinical studies are all future research trends for the application of VR in rehabilitation medicine.

Gestational Diabetes Mellitus (GDM) is related with adverse outcomes for both the mother and the offspring. Immune and senescence play a crucial role in GDM progression. This study aims to explore the diagnostic significance of immune-related senescence (IRS) genes in GDM. We used weighted gene co-expression network analysis (WGCNA) and single sample gene set enrichment analysis (ssGSEA) to compute the immune score and aging score in control and GDM samples. Machine learning identified core IRS genes. Then we performed unsupervised cluster analysis in GDM patients to explore immune infiltration. Finally, we validated the core genes in clinical samples. We used the intersection of MEblack module from WGCNA and differentially expressed genes (DEGs) to obtain the potential genes. Next, a univariate logistic regression model including 23 potential genes were constructed, and these genes were filtered by least absolute shrinkage and selection operator (LASSO) algorithm. There were 5 potential genes (COX17, RRAS2, RRAGC, CECR1, and TACC2), which defined as biomarkers, remained eventually, and the efficacy of these biomarkers was evaluated by nomogram. Finally, the results from both qRT-PCR and western blot analyses demonstrated CECR1 was down-regulated, while TACC2 was up-regulated in GDM placental tissue. Our study identified CECR1 and TACC2 as diagnostic biomarkers for GDM associating with immune and senescence, providing a new perspective on GDM progression.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

The paper deals with exploration of subsequences of polygonal numbers of different sides derived through step-by-step elimination of terms of the original sequences. Eliminations are based on special rules similarly to how the classic sieve of Eratosthenes was developed through the elimination of multiples of primes. These elementary number theory activities, appropriate for technology-enhanced secondary mathematics education courses, are supported by a spreadsheet, Wolfram Alpha, Maple, and the Online Encyclopedia of Integer Sequences. General formulas for subsequences of polygonal numbers referred to in the paper as polygonal number sieves of order k that include base-two exponential functions of k have been developed. Different problem-solving approaches to the derivation of such and other sieves based on the technology-immune/technology-enabled framework have been used. The accuracy of computations and mathematical reasoning is confirmed through the technique of computational triangulation enabled by using more than one digital tool. A few relevant excerpts from the history of mathematics are briefly featured.

New setting is introduced to study failed zero-forcing number and failed zero-forcing neutrosophic-number. Leaf-like is a key term to have these notions. Forcing a vertex to change its color is a type of approach to force that vertex to be zero-like. Forcing a vertex which is only neighbor for zero-like vertex to be zero-like vertex but now reverse approach is on demand which is finding biggest set which doesn’t force. LetNTG : (V,E,σ,μ) be a neutrosophic graph. Then failed zero-forcing number Z(NTG) for a neutrosophic graph NTG : (V,E,σ,μ) is maximal cardinality of a set S of black vertices (whereas vertices in V (G) \ S are colored white) such that V (G) isn’t turned black after finitely many applications of “the color-change rule”: a white vertex is converted to a black vertex if it is the only white neighbor of a black vertex. Failed zero-forcing neutrosophic-number Zn(NTG) for a neutrosophic graphNTG : (V,E,σ,μ) is maximal neutrosophic cardinality of a set S of black vertices (whereas vertices in V (G) \ S are colored white) such that V (G) isn’t turned black afterfinitely many applications of “the color-change rule”: a white vertex is converted to a black vertex if it is the only white neighbor of a black vertex. Failed zero-forcing number and failed zero-forcing neutrosophic-number are about a set of vertices which are applied into the setting of neutrosophic graphs. The structure of set is studied and general results are obtained. Also, some classes of neutrosophic graphs namely path-neutrosophic graphs, cycle-neutrosophic graphs, complete-neutrosophic graphs, star-neutrosophic graphs, bipartite-neutrosophic graphs, and t-partite-neutrosophic graphs are investigated in the terms of maximal set which forms both of failed zero-forcing number and failed zero-forcing neutrosophic-number. Neutrosophic number is reused in this way. It’s applied to use the type of neutrosophic number in the way that, three values of a vertex are used and they’ve same share to construct this number to compare with other vertices. Summation of three values of vertex makes one number and applying it to a comparison. This approach facilitates identifying vertices which form failed zero-forcing number and failed zero-forcing neutrosophic-number. In path-neutrosophic graphs, the set of vertices such that every given two vertices in the set, have distance at least two, forms maximal set but with slightly differences, in cycle-neutrosophic graphs, the set of vertices such that every given two vertices in the set, have distance at least two, forms maximal set. Other classes have same approaches. In complete-neutrosophic graphs, a set of vertices excluding two vertices leads us to failed zero-forcing number and failed zero-forcing neutrosophic-number. In star-neutrosophic graphs, a set of vertices excluding only two vertices and containing center, makes maximal set. In complete-bipartite-neutrosophic graphs, a set of vertices excluding two vertices from same parts makes intended set but with slightly differences, in complete-t-partite-neutrosophic graphs, a set of vertices excluding two vertices from same parts makes intended set. In both settings, some classes of well-known neutrosophic graphs are studied. Some clarifications for each result and each definition are provided. Using basic set not to extend this set to set of all vertices has key role to have these notions in the form of failed zero-forcing number and failed zero-forcing neutrosophic-number. The cardinality of a set has eligibility to form failed zero-forcing number but the neutrosophic cardinality of a set has eligibility to call failed zero-forcing neutrosophic-number. Some results get more frameworks and perspective about these definitions. The way in that, two vertices don’t have unique connection together, opens the way to do some approaches. A vertex could affect on other vertex but there’s no usage of edges. These notions are applied into neutrosophic graphs as individuals but not family of them as drawbacks for these notions. Finding special neutrosophic graphs which are well-known, is an open way to pursue this study. Some problems are proposed to pursue this study. Basic familiarities with graph theory and neutrosophic graph theory are proposed for this article.

In the paper it is demonstrated that a valid path to a contradiction in complex number theory exists. In the path use is made of Euler’s identity and simple trigonometry. Each step can be easily verified.

Saudi Arabia is a prominent producers of dates, with 1.6 million tons annually. There is a need to evaluate physical properties and quality of fruits non-destructively and then be modeled and predicted throughout the storage period. The aim of the current study was to generate a quality index (Qi) and Near-infrared spectra (NIR) models non-destructively to predict properties of Barhi dates fruits including objective and sensory evaluations. The engineering properties of Barhi dates were measured and modeled with quality index (Qi) based on NIR of fresh Barhi fruits (hardness, color, TSS, pH, and sensory evaluations) and during storage in cold, ambient, and controlled at-mosphere (CA) for up to four months. The prediction of Qi is non- destructively based on NIR utilizing PLSR and ANN data analysis. The results showed that the Qi generated corresponds with high precision to the characteristics of the examined fruits through the duration of the storage period with R2 of 0.96. The NIR spectrum proves to be an efficient method to evaluate the Barhi fruits' quality index. where ANN was found to be more suitable than PLSR analysis. Thus, NIR can be utilized to accurately predict the Qi of fruits quality effectively throughout the handling, processing, transporting, storage, and retail sector supply chain.

Manual interpretation of these huge amounts of image volumes are susceptible to inter-reader variability and human error. Thus, accurate automated CAD scheme is highly desirable in clinical pathological diagnosis. In this research, plethora of machine learning paradigms (e.g. feature extraction, dimensionality reduction and supervised classification methods) were explored, evaluated, compared and analyzed to identify the optimal pathway for brain MR images (normal vs neoplastic) binary classification task. External validation dataset was used to test the generalizability of the optimal predictive models implemented. Relevant and informative features were selected to construct cross-validated decision tree and eventually simple rule set was built based on the decision tree. The experimental results show that almost all pattern recognition paradigms achieve high accuracy with careful selection of number of attributes. LDA+ELM with 55 features are the optimal pipelines which achieve perfect classification when training and test data are of same source; and achieving (accuracy=97.5%, AUC=0.989, sensitivity=95% and specificity=100%) under balanced test dataset; (accuracy=99.5%, AUC=0.988, sensitivity=95% and specificity=100%). Cross-validated decision tree model also shows comparable performance: accuracy=98.8%, AUC=99.1%, sensitivity=99.6% and specificity=98.2%. Three highly relevant and robust attributes are visualized and selected for construction of decision tree models and finally a rule sets are read directly off the decision tree. This rule sets can potentially serve as fast and accurate classification algorithm.

The electric vehicle (EV) industry is experiencing rapid growth, accompanied by continuous advancements in charging infrastructure to satisfy the rising need for fast and reliable charging. Particularly, the focus has shifted towards EV fast charging (EVFC) and its impact on the power grid. This paper presents a comprehensive analysis and survey of scholarly literature and projects conducted in this field over the past decade. The findings highlight the rising demand for EVFC and the need to address its potential adverse effects on the power grid. However, there is a noticeable lack of clear research guidance regarding charging time. To tackle these challenges and pave the way for future solutions, extensive research on DC fast charging, ultra-fast charging, and the integration of vehicle-to-grid (V2G) systems is required. This review paper thoroughly investigates the development of fast charging technology for electric vehicles (EVs), including its advantages and comparative analyses from various perspectives. Furthermore, it delves into the advancements in DC fast charging infrastructure, emphasizing charging standards and control modes. The study also investigates different categories of battery chargers for both on-board and off-board charging. Additionally, it explores the classification of DC-DC converters in the context of DC fast charging stations, discusses control strategies for EV systems, identifies existing challenges, and outlines future trends in EV fast charging.

Rapid urbanization has profoundly impacted regional ecosystem services. However, few studies have comprehensively examined the spatiotemporal relationship between multi-dimensional urbanization processes and ecosystem services. This study investigated the spatiotemporal dynamics of urbanization and ecosystem services value (ESV) in the Yangtze River Delta (YRD) region, China, from 2010 to 2020. We measured urbanization levels from two dimensions: Urbanization I (demographic, economic, and land urbanization) and Urbanization II (social and cultural urbanization). The ESV was quantified using the equivalent factor method. The results showed that: (1) The level of Urbanization I increased steadily, while Urbanization II, despite a lower level, exhibited a faster growth rate, especially after 2017; (2) The total ESV declined, with regulating services decreasing the most. The spatial distribution of ESV showed significant heterogeneity; (3) Urbanization had a significant negative correlation with ESV, with Urbanization I exerting a greater negative impact than Urbanization II; (4) The eastern region was dominated by high urbanization-low ESV clusters, while the western region was characterized by low urbanization-high ESV clusters. The findings provide important implications for regional sustainable development and can serve as a reference for related studies in other rapidly urbanizing areas around the world.

The main parameters for calculation of relative humidity are the wet-bulb depression and dry bulb temperature. In this work, easy-to-used predictive tools based on statistical learning concepts, i.e., the Adaptive Network-Based Fuzzy Inference System (ANFIS) and Least Square Support Vector Machine (LSSVM) are developed for calculating relative humidity in terms of wet bulb depression and dry bulb temperature. To evaluate the aforementioned models, some statistical analyses have been done between the actual and estimated data points. Results obtained from the present models showed their capabilities to calculate relative humidity for divers values of dry bulb temperatures and also wet-bulb depression. The obtained values of MSE and MRE were 0.132 and 0.931, 0.193 and 1.291 for the LSSVM and ANFIS approaches respectively. These developed tools are user-friend and can be of massive value for scientists especially, those dealing with air conditioning and wet cooling towers systems to have a noble check of the relative humidity in terms of wet bulb depression and dry bulb temperatures.

In recent years, the Chinese government pays more and more attention to agricultural development and ecological protection. While improving the cultivated land green use efficiency(CLGUE) is the key to promote the sustainable development of agriculture. This study aims to study the current situation and influencing factors of agricultural production from the perspective of green utilization efficiency of cultivated land. It takes 39 cities in the upper, middle and lower reaches of the Yangtze River basin in China as an example. The CLGUE values in those 39 cities from 2011 to 2020 were specifically measured, using the Super-SBM model, kernel density estimation and geographic detector method. Their temporal and spatial heterogeneity was described, and the influencing factors were detected at both single and interactive levels. The results showed that: （1）From 2011 to 2020, the green utilization efficiency value of cultivated land in the Yangtze River Basin showed an upward trend on the whole; （2）There is a clear spatial heterogeneity the CLGUE values in the Yangtze River Basin cities, as shown by: downstream region > midstream region > upstream region; (3) Cultivated land resource endowment, socioeconomic development, and agricultural production technology are important factors affecting the variability of CLGUE values. However, there are some differences in the degree and direction of influence of different influencing factors on different sample subgroups.

Polymethyl methacrylate (PMMA) polymer is widely used in various fields today. In order to thoroughly reveal the structural impact performance of PMMA materials, this paper is based on the comprehensive Johnson-Cook constitutive model and damage failure model, and accurately confirm the J-C constitutive and damage failure model parameters of PMMA through material test data, The dynamic process of steel bullet impacting PMMA plate structure is analyzed by finite element software ABAQUS. The calculation results show that the numerical simulation results in this paper are in good agreement with the experimental test data. Therefore, the feasibility and accuracy of the impact analysis of PMMA structures based on J-C constitutive and damage failure models in this paper are studied. Finally, based on the J-C constitutive model and damage failure model, the variation of the residual velocity of the bullet with the PMMA plate thickness is analyzed in depth, that is, the results show that the residual velocity of the bullet has a certain linear relationship with the plate thickness.

Abstract: The population issue has been increasingly urgent in China in recent years. Fertility desire is an essential component of fertility research. Studies on fertility desire mainly contain two aspects: socio-economic structure and individual family[1]. The psychological structure of individuals in individual families is the primary factor of fertility desire. Based on the parasocial relationship theory, this study analyzed the changes in real behavioral intention achieved by players through the identification and attachment to avatars while constructing parasocial relationships[2]. The results indicate that character attachment can significantly enhance the variables of game concentration and player self-identity, actively mediates parasocial emotions and parasocial cognition, and ultimately increases fertility desire. As a theoretical contribution, this study provides a comprehensive interpretation of the psychology of Chinese players in a Simulation Game and explores the theoretical connections among role attachment, role identity, and parasocial relationships in virtual game players.

This study explores the effects of tempering on the precipitation behavior and impact toughness of high-nickel steel. The specimens underwent double quenching at 870°C and 770°C, followed by tempering at various temperatures. Advanced characterization techniques including optical microscopy (OM), scanning electron microscopy (SEM), and transmission electron microscopy (TEM) were used to elucidate precipitation phenomena. Additionally, electron backscatter diffraction (EBSD) was employed to assess the misorientation distribution after tempering. Charpy impact tests were performed on specimens tempered at different temperatures to evaluate their toughness. The findings reveal that with increasing tempering temperature, the fraction of low-angle grain boundaries decreases, which correlates positively with enhanced impact toughness. The impact toughness peaks at 580°C and then diminishes with further temperature increases.

The Harmonic Graphs Conjecture states that there exists an asymptotic relation involving the Harmonic Index and the natural logarithm as the order of the graph increases. This conjecture, grounded in the novel context of Prime Graphs, draws upon the Prime Number Theorem and the sum of divisors function to unveil a compelling asymptotic connection. By carefully expanding the definitions of the harmonic index and the sum of divisors function, and leveraging the prime number theorem's approximations, we establish a formula that captures this intricate relationship. This work is an effort to contribute to the advancement of graph theory, introducing a fresh lens through which graph connectivity can be explored. The synthesis of prime numbers and graph properties not only deepens our understanding of structural complexity but also paves the way for innovative research directions.

We proposed a novel concept of flight time matrix (FTM). In this work, the proposed FTM was verified first numerically. The numerical simulation revealed perfect results which showed that FTM can be used to assist the nondestructive evaluation of ballistic armor plates using acousto-ultrasonics. Two donated commercial ballistic armor plates were sought for a case study where artificial defects were prepared. The results of FTM were reasonably well. The artificial defects were clearly identifiable in one directional location array and FTM contour graphs. More comprehensive superimpositions of flight time vs location and FTM contour plots can be advanced to a better visualization of the defect presence. The resolution of FTM method is in the range of submillimeter or less. This study demonstrated that AU (acousto-ultrasonics) technique is a field applicable and yet reliable tool for inspection of the hidden defects in body armors. A broader merit of the proposed FTM algorithm is that it may promote the development of specific tools/device for nondestructive evaluations field.

Non-destructive testing is an emerging need in manufacturing processes and in service of ballis-tic armor plates. It has been shown that acoustic emission and ultrasonics are among the most applicable techniques. However, these techniques often require relative sophisticated processing and strong tech background for the evaluators. The purpose of the present work is to develop a flight time based algorithm and to demonstrate this algorithm using commercial multilayered armor plates. We proposed a novel concept of flight time matrix (FTM). In this work, the proposed FTM was verified first numerically. The numerical simulation revealed perfect results which showed that FTM can be used to assist the nondestructive evaluation of ballistic armor plates using acous-to-ultrasonics. Two donated commercial ballistic armor plates were sought for a case study where artificial defects were prepared. The results of FTM were reasonably well. The artificial defects were clearly identifiable in one directional location array and FTM contour graphs. More com-prehensive superimpositions of flight time vs location and FTM contour plots can be advanced to a better visualization of the defect presence. The resolution of FTM method is in the range of submillimeter or less. This study demonstrated that AU (acousto-ultrasonics) technique is a field applicable and yet reliable tool for inspection of the hidden defects in body armors. A broader merit of the proposed FTM algorithm is that it may promote the development of specific tools/device for nondestructive evaluations field.

China historically exhibits spatial differentiation from population distribution to ecological or economic development, and the forest pest control work is an epitome of this tendency. In recent times, global warming, man-made monoculture tree plantations, increasing human population density and intensified international trade aggravate forest pest outbreaks. Although Chinese government has complied with the internationally recommended practices, few stones remain unturned due to existing differential regional imbalance of forest pest distribution and control abilities. Evidence shows that the high-income provinces in the south have taken advantage of economic and technological superiority, resulting in the adoption of more efficient pest-control measures. To the contrary, in economically underdeveloped provinces of the northwest, a paucity of financial support has led to serious threats of pest damage that almost mirrored the demarcations of the Hu Huanyong Line. In this paper, we propose introducing public-private partnership (PPP) model into forest pest control and combining the national strategies to enact regional prevention measures in order to break the current spatially differentiated trends in China.

In the paper, the authors present unified generalizations for the Bell numbers and polynomials, establish explicit formulas and inversion formulas for these generalizations in terms of the Stirling numbers of the first and second kinds with the help of the Faà di Bruno formula, properties of the Bell polynomials of the second kind, and the inversion theorem connected with the Stirling numbers of the first and second kinds, construct determinantal and product inequalities for these generalizations with aid of properties of the completely monotonic functions, and derive the logarithmic convexity for the sequence of these generalizations.

Less aligned emphasis has been given to the COVID-19 infodemic coordinating with the COVID-19 outbreak. Global profusion of tangled monikers and hashtags has found their ways in daily communication and contributed to backlash against Chinese. Official naming efforts against infodemic should be meet with a fair share of identification. Based on brief critical reviews on previous multifarious naming practices, we punctuate heuristic introspection in scientific conventions and sociocultural paradigms. Infodemiological analysis promises to articulate that people around the globe are divided in their favor stigmatized monikers in the public and scientific communities because of perceptual bias. There is no positive correlation between the degree of infection in their territories and collective perceptual bias to COVID-19. The official portfolio “COVID-19” and “SARS-CoV-2” has not become de facto standard usages, but full-fledged official names are excepted to duly contribute to the resilience of negative perceptual bias and collective behavioral propensities.

A symbolic analysis of Archimedes’ periodical number system is developed, from which a natural link emerges with the modern positional number systems with zero. After the publication of Fibonacci’s Liber Abaci, the decimal Indo-Arabic positional system was the basis of the algorithmic and algebraic trend of modern mathematics, but even if zero plays a crucial role in algebra and mathematical analysis, zeroless positional systems show the same capability of producing efficient arithmetical algorithms based on operation tables over digits. The crucial role of digits is assessed, by considering a representation of numbers based on strings in lexicographic order. A new algorithm for the determination of decimal periods is presented,, by remarking the cruciality of this topic in number theory. Periods of ordinal numbers, and enumerations of recursive enumerability are shortly recalled. Concluding remarks are formulated about the deep relationship among numbers and information, which shed new light on a red line passing through the whole history of mathematics

In this paper, we mainly show that generalized hyperharmonic number sums with reciprocal binomial coefficients can be expressed in terms of classical (alternating) Euler sums, zeta values and generalized (alternating) harmonic numbers.

Aiming at the prediction of environmental vibrations induced by elevated high-speed railway, a machine-learning method is developed by combining random forest algorithm and Bayesian optimization, which using the dataset from on-site experiments . When it comes to achieving a rapid and effective prediction of environmental vibration, there is few research on com-parisons and verifications of different algorithms, and neither on parameter tuning and optimi-zation of machine learning algorithms. In this paper, a field experiment is firstly carried out to measure the ground vibrations caused by high-speed trains running on bridge, and then the en-vironmental vibration characteristics are analyzed in view of ground accelerations and weighted vibration levels. Subsequently, three machine-learning algorithms of linear regression, support vector machine and random forest are developed by using experimental database, and their prediction performance are discussed. Finally, two optimization models for the hyperparameter set of random forest algorithm are further compared. It turns out that the integrated random forest algorithm has higher accuracy in predicting environmental vibration than linear regression and support vector machine; the Bayesian optimization has excellent performance and high efficiency in achieving efficient and in-depth optimization of parameters, and can be combined with the RF machine learning algorithm to effectively predict the environmental vibrations induced by the high-speed railway.

In this paper, we investigate some elementary properties of two kinds modified Szasz type basis functions, depending on non-negative parameters. We study some shape preserving properties of these operators concerning monotonicity, convexity, starlikeness, semi-additivity and smoothness.

Fiber-based flexible sensors have promising applications potential in human motion and healthcare monitoring, owing to their merits of lightweight, flexibility, and easy processing. Now, high-performance elastic fiber-based strain sensors with high sensitivity, large working range and excellent durability are in great demand. Herein, we have easily and quickly prepared a highly-sensitive, durable fiber-based strain sensor by dip-coating of highly-stretchable polyurethane (PU) elastic fiber in MXene/ waterborne polyurethane (WPU) dispersion solution. Benefiting from the electrostatic repulsion force between the negatively charged WPU and MXene sheets in the mixed solution, very homogeneous and stable MXene/WPU dispersion was successfully obtained and the interconnected conducting networks were correspondingly formed in coated MXene/WPU shell layer, which makes as-prepared strain sensor exhibit a gauge factor of over 960, a large sensing range of over 90% and detection limit as low as 0.5% strain. As elastic fiber and mixed solution have the same polymer constitute, tight bonding of MXene/WPU conductive composite on PU fibers was achieved, enabling the as-prepared strain sensor endure over 2500 stretching-releasing cycles and thus show good durability. Full-scale human motion detection was also performed by the strain sensor, and a body posture monitoring, analysis, and correction prototype system was developed via embedding the fiber-based strain sensors into sweater, strongly indicating the great application prospect in exercise, sports and healthcare.

Underwater image often exhibit detail blurring and color distortion due to light scattering, impurities, and other influences, obscuring essential textures and details. This presents a challenge for existing super-resolution techniques in identifying and extracting effective features, making high-quality reconstruction difficult. This research aims to innovate underwater image super-resolution technology to tackle this challenge. Initially, an underwater image degradation model was created by integrating random subsampling, Gaussian blur, mixed noise, and suspended particle simulation to generate a highly realistic synthetic dataset, thereby training the network to adapt to various degradation factors. Subsequently, to enhance the network's capability to extract key features, improvements were made based on the symmetrically structured Blind Super-Resolution Generative Adversarial Network (BSRGAN) model architecture. An attention mechanism based on energy functions was introduced within the generator to assess the importance of each pixel, and a weighted fusion strategy of adversarial loss, reconstruction loss, and perceptual loss was utilized to improve the quality of image reconstruction. Experimental results demonstrate that the proposed method achieved significant improvements in Peak Signal-to-Noise Ratio (PSNR) and Underwater Image Quality Measure (UIQM) by 0.85 dB and 0.19, respectively, significantly enhancing the visual perception quality and indicating its feasibility in super-resolution applications.

Since coffee has been shown to influence positively the metabolism of subjects with metabolic syndrome (MetS), we aimed to evaluate the short- and long-term effects of a coffee-based supplement on different features of diet-induced MetS. 24 Sprague Dawley rats were divided into control or nutraceuticals groups to receive a high-fat/high fructose diet with or without a mixture of caffeic acid (30 mg/day), trigonelline (20 mg/day), and cafestol (1 mg/day) for 12 weeks. An additional 11 rats were assigned to an acute crossover study. In the chronic experiment, nutraceuticals did not alter body weight or glycemic control but improved fed hyperinsulinemia and HOMA-IR, and plasma adiponectin levels. The impact of nutraceuticals on post-prandial glycemia tended to be more pronounced after acute administration than at the end of the chronic study. Circulating and intrahepatocellular alanine transaminase activity, assessed by hyperpolarized-¹³C NMR spectroscopy, were reduced by coffee nutraceuticals at endpoint. There was also a tendency towards lower liver triglyceride content and histological steatosis score in the intervention group. In conclusion, a mixture of coffee nutraceuticals improved insulin sensitivity and exhibited hepatoprotective effects in a rat model of MetS. Higher dosages with or without caffeine deserve to be studied in the future.

Functional copy number alterations (fCNAs) are DNA copy number changes with concordant differential gene expression. These are less likely to be bystander genetic lesions and could serve as robust and reproducible tumor biomarkers. To identify candidate fCNAs in neuroendocrine tumors (NETs), we integrated chromosomal microarray (CMA) and RNA-seq differential gene expression data from 31 pancreatic (pNET) and 33 small bowel neuroendocrine tumors (sbNET). Tumors were resected from 47 early disease progression (24 months) patients. Candidate fCNAs that accurately differentiated these groups in this discovery cohort were then replicated using fluorescence in situ hybridization (FISH) on formalin-fixed, paraffin-embedded (FFPE) tissues in a larger validation cohort of 60 pNETs and 82 sbNETs (52 early and 65 late disease progression samples). Logistic regression analysis determined the predictive ability of these biomarkers as well as the assay performance metrics of sensitivity, specificity, and area under the curve. Our results indicate that copy number changes at chromosomal loci 4p16.3, 7q31.2, 9p21.3, 17q12, 18q21.2, and 19q12 may be used as diagnostic and prognostic NET biomarkers. This involves a rapid, cost-effective approach to determine primary tumor site for patients with metastatic liver NETs and to guide risk stratified therapeutic decisions.

Infusions of Camellia sinensis leaves have been known for their health benefits. The ABC method is a method of enriching organic infusion leaves (from Camellia. sinensis) with organic dry and concentrated extracts using organic acacia gum and its application to white tea has provided Qi cha tea®. In the present study, we assessed the content of tea polyphenols and caffeine, and biochemical properties of Qi cha tea® and its botanical constituents. Antioxidant and cell viability activities were determined by the 1,1-diphenyl-2-picrylhydrazyl assay and MTT assay in Caco-2 and human HCT-116 cell lines, respectively. The caffeine, catechin, epicatechin composition of Qi cha tea® was modified with less caffeine and gallic acid and more EGCG than the original white tea. The majority of the tested botanical samples including Qi cha tea® at 50 µg/mL showed similar antioxidant activities, with the exception of Echinacea. The greatest effect was found for white tea. The antioxidant power of the Qi cha tea® (90% at 50 µg/mL for pressurized liquid extraction (PLE) was divided by approximately a factor of 2 (61% at 50 µg/mL for pressurized liquid extraction products (PLEP)) which corresponds to the 48.3 % (mass/mass) white tea original content in the Qi cha tea®. Qi cha tea® showed the lowest activity in the viability of the two cell lines. The application of the ABC (Bio Concentrate Assets®) method to Qi cha tea® using various botanicals and dry extract with the acacia gum as blinder has allowed the development a new innovative functional health beverages which comply with European health claims.

Rice is the grain feeds more than half of the world population. It is an important staple food provides twenty percent of the calories consumed worldwide. Food safety affects the health of consumers. Establishing an effective traceability system is one of the primary measures to protect rice quality and food safety. Blockchain-based traceability system has the characteristics of data tamper-proofing, decentralization, and co-governance. This paper proposed a rice traceability scheme based on blockchain technology that selects the critical nodes in the rice industry chain to construct a blockchain network to achieve transparent data sharing. It is meaningful for both enterprises and consumers. It can let enterprises get the real quality information of rice and related raw materials. Consumers can get the true information of rice and rice products to buy safe and healthy food. The scheme is proved feasible by simulating the traceability of the rice supply chain.

Modern war is sudden and rapid, and once the battle starts, the demand for equipment maintenance and guarantee will show an outburst situation, which puts equipment maintenance and guarantee capability to a severe test. To accurately grasp the civil-military integration of aviation maintenance and guarantee capabilities, it is necessary to evaluate their capabilities. To this end, the evaluation indicator system is established by using the three-dimensional indicator system construction model of "maintenance task → task demand → capability demand", and the evaluation method based on intuitionistic fuzzy entropy and normal grey cloud model is proposed, using intuitionistic fuzzy entropy theory to determine the expert weights and indicator weights, and the grey cloud model theory to determine the capability evaluation level. Finally, the application process of the evaluation model is demonstrated through specific examples, and the evaluation results are analyzed to verify the effectiveness of the evaluation model.

Modern war is sudden and rapid, and once the battle starts, the demand for equipment maintenance and guarantee will show an outburst situation, which puts equipment maintenance and guarantee capability to a severe test. To accurately grasp the civil-military integration of aviation maintenance and guarantee capabilities, it is necessary to evaluate their capabilities. To this end, the evaluation indicator system is established by using the three-dimensional indicator system construction model of "maintenance task → task demand → capability demand", and the evaluation method based on intuitionistic fuzzy entropy and normal grey cloud model is proposed, using intuitionistic fuzzy entropy theory to determine the expert weights and indicator weights, and the grey cloud model theory to determine the capability evaluation level. Finally, the application process of the evaluation model is demonstrated through specific examples, and the evaluation results are analyzed to verify the effectiveness of the evaluation model.