Alkaline and alkaline-thermal activation were used in an attempt to synthesize zeolites using the sedimented illite fraction of raw Devonian clays from the Kuprava clay pit in Latvia. The Si/Al molar ratio of these clays is 2.79. Thermal and hydrothermal treatments were conducted using 6M and 10M NaOH solutions, along with different curing environments. The treated samples were analyzed using XRD, FTIR, and SEM, and were compared to the raw and calcined illite fraction samples. The main phase that forms after alkaline treatment is hydrosodalite (Na8[AlSiO₄]₆(OH)₂∙2H₂O). Using a higher concentration of NaOH leads to a significant increase in hydrosodalite formation. Increasing the curing temperature from 120°C to 600°C slightly reduces hydrosodalite formation due to the crystallization of the nepheline (Na₃K(Al₄Si₄O₁₆)) phase. This phase forms relatively intensively when the chemically treated samples are cured in a nitrogen environment at 600°C, thereby reducing the formation of hydrosodalite. The characteristic layered-fused structure of clay minerals remains in all chemically treated samples when cured at 600°C in air, but it does not remain when cured at the same temperature in nitrogen. The intensive formation of hydrosodalite is mainly achieved through hydrothermal treatment, along with a primary treatment using 10M NaOH. Considering the calculated size of the crystallites, treatment with 6M NaOH and curing at 120°C can also be seen as beneficial for hydrosodalite formation.

Strip steel surface defect recognition research has important research significance in industrial production. Aiming at the problems of defect feature extraction difficulty, slow detection speed and insufficient dataset, YOLOv5 is improved on the basis of YOLOv5, and YOLO-LFPD (Lightweight fine particle detection) model is proposed. By introducing the RepVGG (Re-param VGG) module, the robustness of the model to the surface defect features of strip steel is enhanced, and the expressive ability of the model is improved. FasterNet is used to replace the backbone network, which ensures the accuracy and accelerates the inference speed, making the model more suitable for real-time monitoring. The use of pruning, GA genetic algorithm with OTA loss function method further reduces the model size while better learning the strip steel defect feature information, thus improving the generalisation ability and accuracy of the model. The experimental results show that the introduction of the RepVGG module and the use of FasterNet can well improve the model performance, with a reduction of 48% in the number of parameters, a reduction of 13% in the number of GFLOPs, an inference time of 77% of the original, and an optimal accuracy compared with the network models in recent years. The experimental results on the NEU-DET dataset show that the accuracy of YOLO-LFPD is improved by 3% to 81.2%, which is better than other models, and provides new ideas and references for the lightweight strip steel surface defect detection scenarios and application deployment.

After decades of studies, the pathogenesis of Autism Spectrum Disorder (ASD) remains unclear and there still lackseffective treatment strategies for core symptoms. Our recent work, combined with others’ research in a diversity ofmodels and clinical trials, suggested a concise, but potentially rational theory that can illustrate the key of the pathogenesis and treatment of ASD from the aspect of damage control.

Currently, most deep learning methods cannot solve the problem of scarcity of industrial product defect samples and significant differences in characteristics. This paper proposes an unsupervised defect detection algorithm based on a reconstruction network, which is realized using only a large number of easily obtained defect-free sample data. The network includes two parts: image reconstruction and surface defect area detection. The reconstruction network is designed through a fully convolutional autoencoder with a lightweight structure. Only a small number of normal samples are used for training so that the reconstruction network can be A defect-free reconstructed image is generated. A function combining structural loss and L1 loss is proposed as the loss function of the reconstruction network to solve the problem of poor detection of irregular texture surface defects. Further, the residual of the reconstructed image and the image to be tested is used as the possible region of the defect, and conventional image operations can realize the location of the fault. The unsupervised defect detection algorithm of the proposed reconstruction network is used on multiple defect image sample sets. Compared with other similar algorithms, the results show that the unsupervised defect detection algorithm of the reconstructed network has strong robustness and accuracy.

Human serum albumin (HSA) corona formation at polymer microparticles of a spheroidal shape was studied using dynamic light scattering and laser Doppler velocimetry (LDV). Physicochemical characteristics of the albumin comprising, the zeta potential and the isoelectric point were determined as a function of pH for various ionic strengths. Analogous characteristics of the polymer particles were carried out. The adsorption of albumin on the particles was monitored by electrophoretic mobility measurements (LDV). The stability of the HSA functionalized particle suspensions under various pHs and their electrokinetic properties were determined. The deposition kinetics of the particles on mica, silica and gold sensors were determined in situ by optical microscopy, AFM and by the quartz microbalance (QCM) under diffusion and flow conditions. The obtained results were interpreted in terms of the coarse-grained random sequential adsorption model that allowed to estimate the range of applicability of QCM for determining deposition kinetics of virus and bacteria at abiotic surfaces.

Surface defect detection is a crucial step in the process of automotive wheel production. However, the task possesses challenges due to complex background and a wide range of defect types. In order to detect the defects on the wheel surface accurately and quickly, this paper proposes a YOLOv5-based algorithm for automotive wheel surface defect detection. The algorithm trains and tests the YOLOv5s model using the self-created automotive wheel surface defect dataset, which contains four kinds of defects: linear, dotted, sludge, pinhole. The extensive experimental results demonstrate that the deep learning network trained by our method can achieve an average accuracy of 71.7% and 57.14 FPS. Our findings prove that this detection algorithm performs better than other common target detection algorithms and meets the real-time requirements of industrial applications.

Buckling defect will appear on the outer surface of the deformed ring during constrained ring rolling (CRR) of aluminum alloy thin wall conical ring with inner high ribs (AATWCRIHR), if the geometrical dimension of the ribs doesn't match the wall thickness. To avoid the buckling defect, a quantitative method for characterizing the degree of the buckling defect is proposed using the area of buckling profile. Then an orthogonal experimental scheme was designed taking the width of the middle rib, thickness of wall, and height of the middle rib as design variables and defining the area of buckling profile as optimization objective. Subsequently, a quadratic polynomial response surface model was established by combining the optimization algorithm with the finite element method (FEM), and the geometrical dimension of the middle ribs of the deformed AATWCRIHR is optimized. Also the optimal parameter combination to minimize the area of buckling profile is obtained and verified using FE simulation. Results show that the AATWCRIHR after optimization doesn’t generate the buckling defect during constrained ring rolling, and it is proved that the quantitative buckling defect representation method and the optimization design method based on the response surface model and the finite element simulation results are feasible for the constrained ring rolling process of the AATWCRIHR.

Abstract: For the problem of small target of printed circuit board surface defects and low detection accuracy, the printed circuit board surface defect detection network DCR-YOLO is designed to meet the premise of real-time detection speed and effectively improve the detection accuracy. Firstly, the backbone feature extraction network DCR-backbone, consisting of two CR residual blocks and one common residual block, is used for small target defect extraction on printed circuit boards. Secondly, the SDDT-FPN feature fusion module is responsible for the fusion of high level features to low level features, while enhancing feature fusion for the feature fusion layer where the small target prediction head YOLO Head-P3 is located to further enhance the low level feature representation. the PCR module enhances the feature fusion mechanism between the backbone feature extraction network and the SDDT-FPN feature fusion module at different scales of feature layers. the C5ECA module is responsible for adaptive adjustment of feature weights and adaptive attention to the requirements of small target defect information, further enhancing the adaptive feature extraction capability of the feature fusion module. Finally, three YOLO-Heads are responsible for predicting small target defects for different scales. Experiments show that the DCR-YOLO network model detection Map reaches 98.58%, the model size is 7.73MB, which meets the lightweight requirement, and the detection speed reaches 103.15fps, which meets the application requirements for real-time detection of small target defects.

Reactions of quinones with compounds containing an amino group can produce a wide variety of addition or substitution products that depend on reactivity of both quinone and amino derivative. 6,7-Dichloropyrido[1,2-a]benzimidazole-8,9-diones undergo selective nucleophilic substitution reaction with different benzohydrazides and α-hydroxy-p-quinone imine derivatives stabilized by strong intramolecular hydrogen bond were isolated. Synthesized compounds represent a combination of several structural motifs: benzimidazole core fused with α-hydroxy-p-quinone imine which contains a benzamido fragment. The protonation/deprotonation processes were investigated in a solution using UV-Vis spectroscopy and 1H NMR titration experiment. X-ray crystallography analysis revealed a set of weak non-covalent interactions such as intra- and intermolecular hydrogen bonds and π-π stacking. Additionally, the redox behavior of 6,7-dichloropyrido[1,2-a]benzimidazole-8,9-dione and its p-imino derivative was investigated in acidic and neutral environment using cyclic voltammetry measurements. Cathode material based on 6,7-dichloropyrido[1,2-a]benzimidazole-8,9-dione could act as potential effective active electrode in aqueous electrolyte batteries, however further optimization is required.

Identifying locations of landslide slip surfaces provides critical information for understanding the volume of landslides and the scale of disasters, which is essential for formulating disaster preparedness and mitigation strategies. Based on hydrogeological survey data from 24 deep-seated landslide-prone sites in Taiwan's mountainous regions, this study first developed the hydraulic conductivity potential index (HCPI) using principal component analysis to quantify hydraulic properties of disturbed rock formation with six geological factors. Then, The regression analysis was performed to construct a permeability estimation model for the geological environment of landslides. Finally, the established model was utilized to develop an identification method for potential slip depths in landslide-prone sites. Results indicated a strong relation between HCPI and hydraulic conductivity with a determination coefficient of 0.895. The relation equation confirmed that its generated data concerning the depths of significant changes in hydraulic conductivity could be used to identify potential slip surfaces. Additionally, this study successfully establishes a rule for identifying potential slip zones by summarizing data concerning the generated hydraulic conductivity profiles, stratigraphic lithology, existing inclinometer slip depth records, and groundwater level of landslide sites. This identification method was then applied to predict potential slip depths for ten landslide sites where slip surfaces have not yet occurred. These findings offer a new alternative to having early information on potential sliding depths for timely disaster management and control implementation.

Infrared thermography has already been proven to be a significant method in non-destructive evaluation since it gives information with immediacy, rapidity and low cost. However, the thorniest issue for wider application of IRT is the quantification. In this work, we proposed a specific depth quantifying technique by employing the Gated Recurrent Units (GRU) in composite material samples via pulsed thermography (PT). Carbon Fiber Reinforced Polymer(CFRP) embedded with flat bottom holes were designed via Finite Element Method (FEM) modeling in order to precisely control the depth and geometrics of the defects. The GRU model automatically quantified the depth of defects presented in the CFRP material. The proposed method evaluated the accuracy and performance of synthetic CFRP data from FEM for defect depth predictions.

Polarimetry is used to determine the Stokes parameters of a laser beam. Once all four S0,1,2,3 parameters are determined, the state of polarisation is established. Upon reflection of a laser beam with the defined S polarisation state, the directly measured S parameters can be used to determine the optical properties of the surface, which modified the S-state upon reflection. Here, we demonstrate polarimetry for the determination of surface anisotropies related to birefringence and dichroism from different materials, which have a common feature of linear patterns of different alignments and scales. It is shown that polarimetry in the back-reflected light is complementary to ellipsometry and four-polarisation camera imaging.

For marine vessels, a propeller shaft system, also known as a propulsion shaft system, is an essential changer in engine torque and propeller thrust. The propeller shaft system is subjected to transverse, longitudinal, and torsional excitations during operation. These sources of excitations originate from alternating thrust generated by the propeller, operation of a propeller in a stern flow field which is non-uniform in time and space, misalignment of components such as shafts, bearings, and keyholes in the assembly, excitations in the form of rotational motion, and the whirling motion of the shafts. These dynamic excitations posed a challenging issue for the integrity and reliability of a marine vehicle. Thus, it is crucial to analyze the dynamic response of the propulsion shaft system. The dynamic analysis of the propulsion shaft system is typically conducted using numerical /analytical models. At present, Finite Element Model (FEM) as a numerical model plays a vital role in analyzing the dynamic response of the structure. The computed response and the modal parameters from the FE model are reliable only if accurate boundary conditions, such as stiffness, can be imposed on the model. However, the numerical FE model deviates from the experimental results because of uncertainties in the stiffness values of the bearings and other connectors. This paper uses the Response Surface Optimization (RSO) technique to estimate the unknown stiffness of the bearings used in the propulsion shaft system. The experimental model of the propeller shaft system is constructed from the steady-state response of the system using the step sine excitation. The natural frequencies and the amplitude of vibrations in the FE model are updated using the parametric RSO technique. The updated model shows that the difference in natural frequencies and vibration amplitude is less than 10% between the optimized and experimental models. Propeller Shaft, Vibrations, Optimization, Response Surface

Methylmalonic acidemia (MMA), propionic acidemia (PA), and cobalamin C deficiency (cblC) share a defect in propionic acid metabolism. In addition, cblC is also involved in the process of homocysteine remethylation. These three diseases produce various phenotypes and complex downstream metabolic effects. In this study we used an untargeted metabolomics approach to investigate the biochemical differences and the possible connections with the pathophysiology of each disease. Untargeted urine metabolomic profiles of 21 patients (7 MMA, 7 PA, 7 cblC) were identified through statistical analysis (p<0.05; log2FC >|1|) and then used for the annotation. Annotated features were associated with different metabolic pathways potentially involved in the diseases development. Comparative statistic showed markedly different metabolomic profiles between MMA, PA and cblC, highlighting characteristic species for each disease. The most affected pathways were related to the metabolism of organic acids (MMA, PA, cblC), amino acids (MMA, PA, cblC), glycine and its conjugates (PA), transsulfuration pathway (cblC), oxidative processes (cblC) and neurosteroid hormones (cblC). The untargeted metabolomics study highlighted the presence of significant differences between the three diseases, pointing to the most relevant contrast of cblC profile compared to MMA and PA. Some new biomarkers are proposed for PA, while novel data regarding the alterations of steroid hormone profiles and biomarkers of oxidative stress were obtained for cblC disease. The elevation of neurosteroids in cblC may indicate a potential connection with the development of ocular and neuronal deterioration.

This study presents an advanced defect detection approach for solar cells using the YOLOv10 deep learning model. Leveraging a comprehensive dataset of 10,500 solar cell images, annotated with 12 distinct defect types, our model integrates Compact Inverted Blocks (CIB) and Partial Self-Attention (PSA) modules to enhance feature extraction and classification accuracy. Training on the Viking cluster with state-of-the-art GPUs, our model achieved remarkable results, including a mean Average Precision ([email protected]) of 98.5%. Detailed analysis of the model's performance revealed exceptional precision and recall rates for most defect classes, notably achieving 100% accuracy in detecting black core, corner, fragment, scratch, and short circuit defects. Even for challenging defect types such as thick line and star crack, the model maintained high performance with accuracies of 94% and 96%, respectively. The recall-confidence and precision-recall curves further demonstrate the model's robustness and reliability across varying confidence thresholds. This research not only advances the state of automated defect detection in photovoltaic manufacturing but also underscores the potential of YOLOv10 for real-time applications. Our findings suggest significant implications for improving the quality control process in solar cell production.

The review considers physics and some applications of a new approach that promises to be a breakthrough in efficiency and instrumentation of various methods for nondestructive testing (NDT) of composites. The approach is based on frequency-selective properties of defects which fall into resonance (Local Defect Resonance (LDR)) at certain frequencies. An activation of LDR enables to route the input acoustic energy directly to the defect that dramatically increases its vibration amplitude and thus facilitates defect-selective imaging, rises efficiencies of various derivative acoustic NDT methods (nonlinear, acousto-thermal) and enables to develop some new methodologies, like Resonant Air-Coupled Emission (RACE), machine and remote imaging.

As urbanization continues to increase, key conservation areas like World Heritage sites are being altered. This transformation is a cause for concern as it threatens the Outstanding Universal Value of these sites. To address this issue, a research question was formulated: How urban is World Heritage? The research focused on identifying and monitoring urbanization in heritage core zones listed on the World Heritage by tracking changes in built-up areas from 1985 to 2015. The findings revealed that urban developments, including housing, transport infrastructure construction, visitor accommodation facilities, and land conversions, have significantly impacted heritage properties. More than a third (37\%, 426) of the cultural heritage properties reported urban development, with the highest occurrences in Europe, North America, Asia, and the Pacific. Furthermore, these regions also displayed the highest rate of change per year between 1985 and 2015. This indicates the urgent need to identify and monitor the urbanization of World Heritage to preserve their OUV amidst increasing urban development.

Density functional theory (DFT) calculations of hydrogen adsorption on titanium nitride had previously shown that hydrogen may adsorb on both titanium and nitrogen sites with a moderate adsorption energy. Further, the diffusion barrier was also found to be low. These findings may qualify TiN, a versatile multifunctional material with electronic conductivity, as electrode material for the hydrogen evolution reaction (HER). This was the main impetus of this work which aims to experimentally and theoretically investigate the electrocatalytic properties of TiN-layers that were processed on Ti substrate using reactive ion sputtering. The properties are discussed focusing on the role of oxygen defects introduced during the sputtering process on the HER. Based on DFT calculations, it is shown that these oxygen defects alter the electronic environment of the Ti atoms which entails a low hydrogen adsorption energy in the range of -0.1 eV; this leads to HER performances that match those of Pt-NPs in acidic media. When a few nanometr thick layer of Pd-NPs is sputtered on-top of the TiN-layer, the performance is drastically reduced. This is interpreted in terms of oxygen defects being scavenged by the Pd-NPs near the surface which is thought to reduce the hydrogen adsorption sites.

Laser machining by ultra-short (sub-ps) pulses at high intensity offers high precision, high throughput in terms of area or volume per unit time, and flexibility to adapt processing protocols to different materials on the same workpiece. Here we consider the challenge of optimization for high throughput: how to use the maximum available laser power and larger focal spots for larger ablation volumes by implementing a fast scan. This implies the use of high-intensity pulses approaching ∼PW/cm2 at the threshold where tunnelling ionization starts to contribute to overall ionization. A custom laser micromachining setup was developed and built to enable high speed, large area processing and easy system reconfiguration for different tasks. The main components include laser, stages, scanners, control system, and software. Machining of metals such as Cu, Al, or stainless steel, and fused silica surfaces at high-fluence and high-exposure doses at high scan speeds up to 3 m/s were tested for the fluence scaling of ablation volume, which was found to be linear. Modified surfaces are color-classified for their appearance, which is dependent on surface roughness and chemical modification. Such colour-coding can be used as a feedback parameter for industrial process control.

The primary objective of this study was to demonstrate the potential of digital image analysis as a tool to identify microplastic (MP) particles in surface waters and to facilitate their characterisation in terms of 2D and 3D morphology. Digital image analysis preceded by microscopic analysis was used for an exhaustive quantitative and qualitative evaluation of MPs isolated from the Vistula river. Using image processing procedures, 2D and 3D shape descriptors were determined. The Principal Components Analysis (PCA) was used to interpret the relationships between the parameters studied, characterising MP particle geometry, type and colour. This multivariate analysis of the data allowed 3 or 4 main factors to be extracted, explaining approximately 90% of the variation in the data characterising MP morphology. It was found that the first principal component for granules, flakes and films was largely represented by strongly correlated with 2D shape descriptors (area, perimeter, equivalent area diameter) and 3D shape descriptors (CSF, Compactness, Dimensionality). Considering the scraps, PC1 was represented by only five of the above descriptors, and the Compactness variable had the largest contribution to PC2. In addition, for granules, flakes and films, a relationship between 2D shape and the colour of their particles could be observed. For the most numerous MP group identified of multicoloured scraps, no such association was found. The results of our study can be used for further multivariate analysis regarding the presence of microplastic floating on the river surface, with a particular focus on particles of secondary origin. This is of key importance for optimising future efforts in conducting small-scale and multidimensional monitoring of and reducing plastics in the aquatic environment.

According to many research groups, high glucose induces over production of superoxide anions, and reactive oxygen species (ROS) in general is the link between high glucose levels and the toxicities seen at cellular levels. Respiratory complex anomalies could lead to the production of ROS. Calcium [Ca2+], at physiological levels serves as a second messenger in many physiological functions. Accordingly, mitochondrial calcium [Ca2+]m overload leads to ROS production which could be lethal to the mitochondria through various mechanisms. The F1F0-ATPase (ATP syn-thase or complex V) is the enzyme that is responsible for catalyzing the final step of oxidative phosphorylation. It does so by coupling the translocation of protons in the mitochondrial in-termembrane space and shuttling them to the mitochondrial matrix for ATP synthesis to take place. Mitochondrial complex V T8993G mutation specifically blocks the translocation of protons across the intermembrane space thereby blocking ATP synthesis leading to Neuropathy, Ataxia and Retinitis Pigmentosa Syndromes (NARP). This study seeks to explore the possibility of [Ca2+]m overload mediating the pathological roles of high glucose in defective respiratory chain mediated mitochondrial stress. The NARP cybrids are the in vitro experimental models for the cells with F1FO-ATPase defects, these cells harbor 98% of mtDNA T8993G mutation. Their coun-terparts 143B osteosarcoma cell lines are the parental cell lines used for comparisons. We uncov-ered that, NARP cells mediated and enhanced the death of the cells (apoptosis) when incubated with hydrogen peroxide (H2O2) and high glucose respectively as depicted by the MTT assay of cell viability. Furthermore, using the fluorescence probe-coupled laser scanning confocal imag-ing microscopy, NARP cells significantly enabled mitochondrial reactive oxygen species (mROS) formation and enhanced the depolarization of the mitochondrial membrane potential (ΔΨm). Elucidating the mechanisms of sugar enhanced toxicity on mitochondria would help in the fu-ture to alleviate the symptoms of patients associated with (NARP) syndromes.

Polyetheretherketone is a promising material for implants due to its good mechanical properties and excellent biocompatibility. Its accessibility to a wide range of applications is facilitated by the ability to process it with an easy-to-use manufacturing process such as Fused Filament Fabrication. The elimination of disadvantages associated with the manufacturing process, such as a poor surface quality, is a main challenge to deal with. As part of the mass finishing process, centrifugal disc finishing has demonstrated good results in surface optimization, making it a promising candidate for post-processing of additively manufactured parts. The objective of this study is to identify the key parameters of the centrifugal disc finishing process on the waviness of additively manufactured PEEK specimen, which has not been investigated yet. Waviness of the specimen was investigated by means of confocal laser scanning microscopy (CLSM), while weight loss was additionally tracked. Six parameters were investigated: type, amount and speed of media, use of compound, amount of water and time. Type of media, time and speed were found to significantly influence waviness reduction and weight loss. Surface electron microscopy images demonstrated the additional effects of deburring and corner rounding. Results on previous studies with specimens made of metal showed similar results. Further investigation is required to optimise waviness reduction and polish parts in a second post-processing step.

In order to solve the problem of structure damage location and degree identification, the weighted mean of vectors algorithm (INFO), a high-performance optimization one, was first introduced to identify structure damage. The genetic algorithm (GA) are improved to obtain a refined genetic algorithm (RGA). An objective function is constructed by combining the dynamic response transfer-ratio without modal analysis. INFO and RGA algorithms are used to optimize the objective function for damage identification. Though simulations, the INFO, RGA, GA algorithms were used to identify the damage on a simply supported beam and cantilevered plate with different levels of noise and different frequency spacing of pickup points. The simulations verify the effectiveness of the three damage identification methods, and the INFO algorithm has the highest damage identification accuracy, the RGA is second and the GA is the worst.

The unique structure of G4.0 PAMAM dendrimers allows the drug to be enclosed in internal spaces or immobilized on the surface. In the conducted research, the conditions for the formation of the active G4.0 PAMAM complex with doxorubicin (DOX) were optimized. The physicochemical properties of the system were monitored using DLS, CD, and fluorescence spectroscopy. The QCM-D method was chosen to determine the preferential conditions for the complex formation. The highest binding efficiency of the drug to the cationic dendrimer was observed under basic conditions when the DOX molecule was deprotonated. The decrease in the zeta potential of the complex confirms that DOX immobilizes through electrostatic interaction with the carrier's surface amine groups. The binding constants were determined from the fluorescence quenching of the DOX molecule in the presence of G4.0 PAMAM. The two-fold way of binding doxorubicin in the structure of dendrimers was visible in the ITC isotherm. Fluorescence spectra and release curves identified reversible binding of DOX to the nanocarrier. Among the selected cancer cells, the most promising anticancer activity of G4.0-DOX was observed in A375 malignant melanoma cells. Moreover, the preferred intracellular location of the complexes concerning the free drug was found, which is important from a therapeutic point of view.

Accurate prediction of defects in software components plays a vital role in administrating the quality of the quality and efficiency of the system to be developed. So we have written a systematic literature review in order to evaluate the four main defect prediction techniques. Defect prediction paves way for the testers to find bugs and modify them in order to achieve input to output conformance. In this paper we have discussed the open issues in predicting software defects and have provided with a detailed analyzation of different methods including Machine Learning, Integrated Approach, Cross-Project and Deep Forest algorithm in order to prevent these flaws. However, it is almost impossible to rule which method is better than the other so every technique can be analyzed separately and the best technique according to the problem at hand can be used or can be altered to create hybrid technique suitable for the cause.

A simple design of an ultrathin six-band polarization-insensitive terahertz perfect metamaterial absorber (PMMA) composed of a metal cross-cave-patch resonator (CCPR) placed over a ground plane was proposed and investigated numerically. The numerical simulation results demonstrate that the average absorption peaks are up to 95% at six resonance frequencies with high quality-factors (>65). In addition, the absorption properties can be kept stability for both normal incident transverse magnetic (TM) and transverse electric (TE) waves. The physical mechanism behind the observed high level absorption is illustrated by the electric and power loss density distributions. The different absorption mainly originates from the higher order multipolar and multipolar plasmon resonance of the structure, which are sharp different to the most previous studies of the PMMAs. Furthermore, the resonance absorption of the PMMA can be tunable by varying the geometric parameters of the unit cell.

A simple design of an ultrathin six-band polarization-insensitive terahertz perfect metamaterial absorber (PMMA) composed of a metal cross-cave-patch resonator (CCPR) placed over a ground plane was proposed and investigated numerically. The numerical simulation results demonstrate that the average absorption peaks are up to 95% at six resonance frequencies with high quality-factors (>65). In addition, the absorption properties can be kept stability for both normal incident transverse magnetic (TM) and transverse electric (TE) waves. The physical mechanism behind the observed high level absorption is illustrated by the electric and power loss density distributions. The different absorption mainly originates from the higher order multipolar and multipolar plasmon resonance of the structure, which are sharp different to the most previous studies of the PMMAs. Furthermore, the resonance absorption of the PMMA can be tunable by varying the geometric parameters of the unit cell.

Air pollution has become the world’s single biggest environmental health risk of the past decade, causing about 7 million yearly deaths worldwide. One of the dominant air pollutants is fine particulate matter (PM2.5), a product of combustion. Exposure to PM2.5 has been associated with decreased lung function, impaired immunity, and exacerbations of lung disease. Accumulating evidence suggests that many of the adverse health effects of PM2.5 exposure are associated with lung inflammation and oxidative stress. While the physical structure and surface chemistry of PM2.5 are surrogate measures of particle oxidative potential, little is known about their contributions to negative health effects. In this study, we used functionalized carbon black particles as surrogates for atmospherically aged combustion formed soot to assess the effects of PM2.5 surface chemistry in lung cells. We exposed the BEAS-2B lung epithelial cell line to different soot at a range of concentrations, and assessed cell viability, inflammation, and oxidative stress. Our results indicate that exposure to soot with varying particle surface composition results in differential cell viability rates, expression of pro-inflammatory and oxidative stress genes, and protein carbonylation. We conclude that particle surface chemistry, specifically oxygen content, in soot modulates lung cell inflammatory and oxidative stress responses.

This review provides a comprehensive and updated information on chalcones, presenting their sources, methods of identification and properties putting emphasis on applications in agricultural industry. Vast exploitation of synthetic pesticides led to the weed and pest resistance issue, causing economic loss but more importantly health risk due to pesticide overuse. Because one of the aim of the European Green Deal 2030 is the Farm to Fork strategy which targets on reducing by 50% the use of chemical pesticides by 2030, and push towards natural pesticides which are more environmentally friendly and restore natural resources, chalcones and their derivatives seem to fit perfectly. They have herbicidal, fungicidal, bactericidal and antiviral properties. Moreover, chalcones are naturally occurring substances, known for their favorable health effect for years, working on many areas. This review is complementary to the previous ones describing chalcones use in agriculture, updates them but additionally shows methods of detection.

Axial resolution is one of the most important characteristics of a microscope. In all microscopes, a high axial resolution is desired in order to discriminate information efficiently along the longitudinal direction. However, when studying thick samples that do not contain laterally overlapping information, a low axial resolution is desirable as information from multiple planes can be recorded simultaneously from a single camera shot instead of plane-by-plane mechanical refocusing. In this study, we increased the focal depth of an infrared microscope non-invasively by introducing a binary axicon fabricated on barium fluoride substrate close to the sample. Preliminary results of imaging thick and sparse silk fibers showed an improved focal depth with a slight decrease in lateral resolution and increase in background noise.

Researchers have explored primary colour-geometric shape associations since Kandinsky's correspondence theory. However, there is a gap in the literature regarding interior colour applications on surface shapes. To address this gap, an online study was employed to gather data with one hundred participants who were asked to choose their preferred colours for shapes on bedroom walls with follow-up questions on the colour-shape semantic associations, their preference of colours and shapes on bedroom walls independently in addition to their favourite colour, their favourite shape, and colour-shape pairs without interior context. The results revealed that colour-shape preferences in interiors differ from those found in psychology studies, other colour applications on bedroom walls, and other preferences, indicating that colour preference is context-dependent. Interestingly, the most popular colour for surface shapes on bedroom walls is purple, followed by brown and blue. The study contributes to the existing literature by providing colour charts for bedroom applications for professionals in the industry, their clients/users, and future studies.

The identification of spatiotemporal heterogeneity, its key determinants, and the interaction effects between the driving factors of urban resilience (UR) within and between subregions is fundamental for understanding its underlying mechanisms. A resilience evaluation model was applied to analyze the temporal and spatial differences in UR in Hunan Province, China. The standard deviation ellipse was used to explore the spatial and dynamic evolution and direction of UR. A hot spot analysis identified clusters of cold and hot spots. The contribution of spatiotemporal differences in UR within and between subregions was assessed using the Theil index. A geodetector analysis determined the factors influencing UR and their interactions. There was an increasing trend in UR from 0.2692 in 2014 to 0.3422 in 2022. The number of cities with high resilience gradually increased from 2014 to 2022, while there was a decreasing gradient in UR from northeast to southwest across the province. High-resilience cities had positive spillover effects on the surrounding area. Hot spots were predominantly located in the northeast, while cold spots were concentrated in the southwest. The barycenter of UR shifted from northeast to southwest by 2018, before moving southeast by 2022. The Theil index values declined over time both within and between subregions. Per capita GDP, average wages of on-the-job employees, per capita social consumption, and doctor density enhanced UR. Two-factor interactions had a greater influence on the spatiotemporal heterogeneity of UR than single factors. Two-factor and nonlinear enhancements were identified as the primary mode of influence.

Software defect prediction models enable test managers to predict defect-prone modules and assist with delivering quality products. A test manager would be willing to identify the attributes that can influence defect prediction and should be able to trust the model outcomes. The objective of this research is to create software defect prediction models with a focus on interpretability. Additionally, it aims to investigate the impact of size, complexity, and other source code metrics on the prediction of software defects. This research will also assess the reliability of cross-project defect prediction. Well-known machine learning techniques such as support vector machines, k-nearest neighbors, random forest classifiers, and artificial neural networks were applied to publicly available PROMISE datasets. The interpretability of this approach has been demonstrated by SHapley Additive exPlanations (SHAP) and local interpretable model-agnostic explanations (LIME) techniques. The developed interpretable software defect prediction models showed reliability on independent and cross-project data. Finally, the results demonstrate that static code metrics can contribute to the defect prediction models, and the inclusion of explainability assists in establishing trust in the developed models.

Sulfate, the main dissolved contaminant in acid mine drainage (AMD), is ubiquitous in watersheds affected by coal and metal mining operations worldwide. Engineered passive bioremediation systems (PBS) are low-cost technologies that remediate sulfate contamination by promoting (1) precipitation of sulfate-bearing compounds, such as schwertmannite and gypsum; and (2) microbially-mediated sulfate reduction (BSR) to sulfide with subsequent precipitation of sulfide minerals. In this study, chemical and sulfur isotopic data are used to infer multiple pathways for sulfate sequestration in the Tab-Simco PBS. By simultaneously monitoring sulfate concentrations and δ34SSO4 values at four sampling points across the PBS, we (1) identified that the organic layer within the bioreactor was the primary site of BSR processes contributing to sulfate sequestration; (2) observed seasonal variations of BSR processes; (3) estimated that initially the BSR processes contributed up to 30% to sulfate sequestration in the Tab-Simco bioreactor; and (4) determined that BSR contribution to sulfate sequestration continuously declined over the PBS operational lifetime. Together, our results highlight the utility of combining geochemical and microbial fingerprinting techniques to decipher complementary processes involved in sulfur cycling in a PBS as well as the value of adding the sulfur isotope approach as an essential tool to help understand, predict, prevent and mitigate sulfate contamination in AMD-impacted systems.

The Eurasian grapevine (Vitis vinifera L.) is the most widely grown horticultural crop in the world and is important for the economy of many countries. In the wine production chain, grape varieties play an important role as they directly influence the authenticity and classification of the product. Identifying the different grape varieties is therefore fundamental for quality control and inspection activities, as well as for regulating production. Currently, ampelography and molecular analysis are the main approaches to identifying grape varieties. However, both methods have limitations. Ampelography is subjective and prone to errors and is experiencing enormous difficulties as ampelographers are increasingly scarce. On the other hand, molecular analyses are very demanding in terms of cost and time. In this scenario, Deep Learning (DL) and Machine Learning (ML) methods have emerged as a classification alternative to deal with the scarcity of ampelographs and avoid molecular analyses. In this study, the most recent and current methods for identifying grapevine varieties using DL classification-based approaches are presented through a systematic literature review. The classification pipeline of the 31 studies found in the literature was described, highlighting its pros and cons. Most of the studies used DL-based models trained with leaf images acquired in a controlled environment at a maximum distance of 1.2 metres to classify grape varieties. In addition, there is a large gap between practical applications and the datasets used: a great lack of varieties, limited data acquired in the field and a lack of tests on plants under adverse conditions. Potential directions for improving this area of research were also presented.

The amount of solar energy produced is directly proportional to the surface area of solar panels exposed to sun rays. To increase the productivity of solar panels, a number of techniques are proposed by curving the surface or protruding the panel surface to maximise the surface area, e.g. Protruding panel surfaces with shapes such as pyramidal, cone, spherical cap, sinusoidal wavy curve, etc. These techniques are analysed to determine whether the panel surface area increases. The geometrical design analysis showed that, depending on the chosen surface curving method, the panel can achieve a remarkable increase in surface area.The system advisor model was used to assess a sample of solar cells with standard measurements of 6 by 6 inches that were organised in a zigzag pattern with different angles of inclination (10°, 15°, 20°, 25°, 30°, and 35°). Overall, the maximum power pump and annual AC energy performance increase by 1.4%, 4.2%, 6.8%, 10.8%, 14.9%, and 21.6%, respectively, over a one-year period of productivity. However, by applying the concept of solar panel efficiency degradation due to tilting solar panels at an angle by Mamun et al. (2022), for each 5° increase in tilt angle beyond the ideal 10°, the efficiency decreases by approximately 0.76%. In conclusion, the overall efficiency is greater than that of standard flat solar panels, provided the tilt angle is within a reasonable range.

Secondary microplastic (MPL) and nanoplastic (NPL) particles exhibit different physiochemical characteristics that attenuate their toxicities in different ways: some particle types being well documented (primary) while other (secondary), are more unknown. Fourier Transform Infrared Spectroscopy (FTIR), Raman, Proton Nuclear Magnetic Resonance (H-NMR), Curie Point-Gas Chromatography-Mass Spectrometry (CP-gc-MS), Induced Coupled Plasma-Mass Spectrometry (ICP-MS), Nanoparticle Tracking Analysis (NTA), Field Flow Fractionation-Multiple Angle Light Scattering (FFF-MALS), Differential Scanning Calorimetry (DSC), Thermogravimetry (TGA), Differential Mobility Particle [Sizing] (DMPS), Scanning Electron Microscopy (SEM), Transmission Electron Microscopy (TEM), and Scanning Transmission X-ray Microspectroscopy (STXM) are re-viewed as part of a suite of characterization methods for physiochemical ascertainment and distinguishment. Organizations, like the water treatment or waste management industry, and those in groups that bring awareness to this issue, which are in direct contact with the hydrosphere, can utilize these techniques in order to sense and remediate this plastic polymer pollution. The primary goal of this review paper is to highlight the extent of plastic pollution in the environment as well as introduce its effect on the biodiversity of the planet while underscoring current characterization techniques in this field of research. The secondary goal involves illustrating current and theoretical avenues in which future research needs to address and optimize MPL/NPL remediation, utilizing nanotechnology, before this sleeping giant of a problem awakens.

Deep learning methods paired with sidescan sonar (SSS) are commonly used in underwater search and rescue operations for drowning victims, wrecks, and airplanes. However, these techniques are primarily designed to detect mine-like objects and are rarely applied to identifying features in dynamic dredge pit environments, due to a lack of datasets. In this study, we present a Sandy Point Dredge Pit (SPDP) dataset, in which high-resolution SSS data were collected from the west flank of Mississippi bird foot delta of the Louisiana inner shelf. This dataset contains a total of 385 SSS images. We introduce an Effective Geomorphology Classification model (EGC). By ablation studies, we analyze the utility of transfer learning on different model architectures and the impact of data augmentations on model performance. This EGC model will make geomorphic features identification in dredge pit environments quick and efficient which requires extensive experience and professional knowledge. The combination of SSS images and EGC model is a cost-effective and valuable toolkit for hazards monitoring in marine dredge pit environment. The SPDP SSS images dataset, especially the feature of pit wall without rotational slump, is also valuable for other machine learning modelers.

It is meaningful to monitor and identify the concrete cracks as they will seriously reduce the fatigue life of pavement. In this paper a new method based on distributed long-gauge optic fiber sensing is proposed to implement the crack identification. Firstly, the damage indicator, namely strain curve envelope area ratio (SCEAR), is proposed and calculated with the measured strain in time series when the plane goes across the pavement where the sensors are installed. Then the indicators with different sensors are normalization by the value of the indicator from one referenced sensor where damage normally will not happen. If the crack happens within the sensing gauge of the sensor, the value of damage indicator SCEAR from the sensor will increase. Therefore, the crack will be identified with the change of the damage indicator. The effect of the proposed method is first verified by some simulations of prefabricated pavement as the cracks can be accurately identified by the proposed method. Moreover, the influence from the aircraft, such as taxiing position, aircraft load and aircraft type, is not obvious enough to mislead the identification results. Lastly the static loading tests were implemented with one small-scale model of prefabricated concrete pavement in the lab. From the experimental results the prefabricated cracks inside the pavement slab can be identified accurately with the proposes method as the parameter SCEAR is increased by about 100% at the crack position, while it is only changed by about 3% at the undamaged position.

Sunflower is one of the oil crops and its planting areas was listed behind Soybean, peanut and rapeseeds in China. It will encounter different kind of diseases during planting, thus limited the seeds yield. Fusarium species are the major threat to different crops nowadays, it is very important to identify the species caused diseases on different hosts, so that the potential control measures may be explored. In Inner mongolia, Sunflower Disk Rot (SDR) was found in different sunflower planting field, the average infection ratio around 8.50%, typically in some verieties, its infection ratio reach to 11.67%. The diseased receptacle were collected from different locations and Koch’s postulate was conducted. The results showed that Fusarium verticillioides was the main causal agent caused SDR. Fungicide toxicity tests shown that Fludioxonil and Flutolanil were screened out from six fungicides for controlling F. verticillioides, with EC50 values of 0.05 µg/mL (R = 0.9825) and 0.96 µg/mL (R = 0.9964) , respectively. This is the first report of SDR caused by F. verticillioides, and it will alert sunflower reseachers to include SDR in the disease list, so as to control sunflower diseases with integrated management strategy successfully.

Infrared thermography has already been proven to be a significant method in non-destructive evaluation since it gives information with immediacy, rapidity, and low cost. However, the thorniest issue for the wider application of IRT is quantification. In this work, we proposed a specific depth quantifying technique by employing the Gated Recurrent Units (GRU) in composite material samples via pulsed thermography (PT). Finite Element Method (FEM) modeling provides the economic examination of the response pulsed thermography. In this work, Carbon Fiber Reinforced Polymer (CFRP) specimens embedded with flat bottom holes are stimulated by a FEM modeling (COMSOL) with precisely controlled depth and geometrics of the defects. The GRU model automatically quantified the depth of defects presented in the stimulated CFRP material. The proposed method evaluated the accuracy and performance of synthetic CFRP data from FEM for defect depth predictions.

Software defect prediction is an important means to guarantee software quality. Because there are no sufficient historical data within a project to train the classifier, cross-project defect prediction (CPDP) has been recognized as a fundamental approach. However, traditional defect prediction methods using feature attributes to represent samples, which can not avoid negative transferring, may result in poor performance model in CPDP. This paper proposes a multi-source cross-project defect prediction method based on dissimilarity space ( DM-CPDP). This method first uses the density-based clustering method to construct the prototype set with the cluster center of samples in the target set. Then, the arc-cosine kernel is used to form the dissimilarity space, and in this space the training set is obtained with the earth mover’s distance (EMD) method. For the unlabeled samples converted from the target set, the KNN algorithm is used to label those samples. Finally, we use TrAdaBoost method to establish the prediction model. The experimental results show that our approach has better performance than other traditional CPDP methods.

Long COVID is a phenomenon in which individuals experience persistent symptoms after recovering from COVID-19. The symptoms are discovered to be unique for every individual and can affect multiple organs systems in the body. This study aims to identify effective natural remedies for long COVID by analyzing hub genes associated with the symptoms of the condition and evaluating the repurposed drugs catered and used for treating the symptoms of long COVID. The most common and prevalent symptoms of long COVID were identified; Fatigue, Shortness of Breath, Loss of Smell, Headache, Brain Fog, Chest Pain, Insomnia, Heart Palpitations, Dizziness, Joint Pain, Depression, Anxiety, Tinnitus, Loss of Appetite. Hub genes for each of the symptoms provided an insight on the key biological pathways of the symptom. Repurposed drugs identified, provided the template to identify the natural compounds with similar structure as a potential therapeutic drug. The natural compounds were retrieved using fingerprint search of the repurposed drugs from the NPASS Database. The findings of this study suggest several natural remedies for each symptom based on the molecular docking of the hub gene and natural compound using iGEMDOCK. The identified natural remedies may hold promise in treating long COVID, but further research is required to explore the efficacy and effectiveness of the proposed natural compounds. The results of the study pose important implications for the development of effective treatments for long COVID.

In the field of quality control, the critical challenge of analyzing microdefects in steel filament holds significant importance. This is particularly vital as steel filaments serve as reinforced fibers in the use and applications within various component manufacturing industries. This paper addresses the crucial requirement of identifying and investigating microdefects on steel filaments. Eddy current signals are used for the identification of microdefects, and an in-depth investigation is conducted. The core objective is to establish the relationship between the depth of defects and the signals detected through the eddy current sensing principle. The threshold of eddy current instrument was set at 10%, corresponding to a created depth of 20 µm, to identify defective specimens. A total of 30 defective samples were analyzed, and the phase angles between the experimental and theoretical results were compared. The depths of defects ranged from 20 to 60 µm, with one sample having a depth exceeding 75 µm. The calculated threshold of 10.18% closely aligns with the set threshold of 10%, with a difference of only 1.77%. The resulting root mean square error (RMSE) was found to be 10.53 degrees, equivalent to 3.49 µm for the difference in depth and phase between measured results and estimated results. This underscores the methodology's accuracy and its applicability across diverse manufacturing industries.

The variation of aerosols, especially dust aerosol, in time and space plays an important role in climate forcing studies. Aerosols can effectively reduce land surface longwave emission and re-emit energy at a colder temperature, making estimation of downwelling surface longwave radiation (DSLR) with satellite data difficult. Using the latest atmospheric radiative transfer code (MODTRAN 5.0), we simulate the outgoing longwave radiation (OLR) and DSLR under different land surface and atmospheric profile conditions. The results show that dust aerosol has an obvious “warming” effect to longwave radiation compared with other aerosols, that aerosol longwave radiative forcing (ALRF) increased with increasing aerosol optical depth (AOD), and that the atmospheric water vapor content (WVC) is critical to the understanding of ALRF. A method is proposed to improve the accuracy of DSLR estimation from satellite data for the skies under heavy dust aerosols. The AOD and atmospheric WVC under cloud-free conditions with a relatively simple satellite-based radiation model that yields the high accurate DSLR under heavy dust aerosol are used explicitly as model input to reduce the effects of dust aerosol on the estimation of DSLR. Validations of the proposed model with satellites data and field measurements show that it estimates the DSLR accurately under heavy dust aerosol skies. The root mean square errors (RMSEs) are 20.4 W/M² and 24.2 W/M² for Terra and Aqua satellites, respectively, at the Yingke site, and the biases are 2.7 W/M² and 9.6 W/M², respectively. For the Arvaikheer site, the RMSEs are 23.2 W/M² and 19.8 W/M² for Terra and Aqua, respectively, and the biases are 7.8 W/M² and 10.5 W/M², respectively. The proposed method is especially applicable to acquire relatively high accurate DSLR under heavy dust aerosol using MODIS data with available WVC and AOD data.

This paper presents a system for identification of wind features, such as gusts and wind shear. These are of particular interest in the context of energy-efficient navigation of Small Unmanned Aerial Systems (UAS). The proposed system generates real-time wind vector estimates and a novel algorithm to generate wind field predictions. Estimations are based on the integration of an off-the-shelf navigation system and airspeed readings in a so-called direct approach. Wind predictions use atmospheric models to characterize the wind field with different statistical analyses. During the prediction stage, the system is able to incorporate, in a big-data approach, wind measurements from previous flights in order to enhance the approximations. Wind estimates are classified and fitted into a Weibull probability density function. A Genetic Algorithm (GA) is utilized to determine the shaping and scale parameters of the distribution, which are employed to determine the most probable wind speed at a certain position. The system uses this information to characterize a wind shear or a discrete gust and also utilizes a Gaussian Process regression to characterize continuous gusts. The knowledge of the wind features is crucial for computing energy-efficient trajectories with low cost and payload. Therefore, the system provides a solution that does not require any additional sensors. The system architecture presents a modular decentralized approach, in which the main parts of the system are separated in modules and the exchange of information is managed by a communication handler to enhance upgradeability and maintainability. Validation is done providing preliminary results of both simulations and Software-In-The-Loop testing. Telemetry data collected from real flights, performed in the Seville Metropolitan Area in Andalusia (Spain), was used for testing. Results show that wind estimation and predictions can be calculated at 1 Hz and a wind map can be updated at 0.4 Hz. Predictions show a convergence time with a 95% confidence interval of approximately 30 s.

The structure and physicochemical properties of polyvinyl alcohol (PVA) and PVA/glycerol films have been investigated by Fourier-transform infrared spectroscopy (FT-IR), X-ray Diffraction (XRD), thermogravimetry/differential thermal analysis (TG/DTA), and advanced scanning probe microscopy (SPM). In the pure PVA films, SPM allowed us to observe ribbon-shaped domains with a different frictional and elastic contrast, which apparently originated from a correlated growth or assembly of PVA crystalline nuclei located within individual PVA clusters. The incorporation of 1.0 wt.% glycerol led to modification in shape of those domains from ribbon-like in pure PVA to rounded in PVA/glycerol 1.0 wt.% films; changes in the relative intensities of the XRD peaks and a decrease of the amorphous halo in the XRD pattern were also detected, while the DTA peak corresponding to the melting point remained at almost the same temperature. For higher glycerol content, FT-IR revealed additional glycerol-characteristic peaks presumably related to the formation of glycerol aggregates, and XRD, FT-IR, and DTA all indicated a reduction in crystallinity. For more than 2.0 wt.% glycerol, the plasticization of the films complicated the acquisition of SPM images without tip-induced surface modification. Our study contributes to the understanding of crystallinity in PVA and how it is altered by a plasticizer such as glycerol.

The surface velocity of the Amery Ice Shelf (AIS) is vital to assessing its stability and mass balance. Previous studies have shown that the AIS basin has a stable multi-year average surface velocity. However, spatiotemporal variations in the surface velocity of the AIS and the underlying physical mechanism remain poorly understood. This study combined offset tracking and DInSAR methods to extract the monthly average surface velocity of the AIS and obtained the inter-annual surface velocity from the ITS_LIVE product. An uneven spatial distribution in inter-annual variation of the surface velocity was observed between 2000–2022, although the magnitude of variation was small at less than 20.5 m/yr. The increase and decrease in surface velocity on the eastern and western-central sides of the AIS, respectively, could be attributed to the change in the thickness of the AIS. There was clear seasonal variation in monthly average surface velocity at the eastern side of the AIS between 2017–2021, which could be attributed to variations in the area and thickness of fast-ice and also to variations in ocean temperature. This study suggested that changes in fast-ice and ocean temperature are the main factors driving spatiotemporal variation in the surface velocity of the AIS.

High quantities of biomass produced in greenhouses create environmental problems, as this side stream and its downgraded products are not further used in the production cycle. The aim of our research was the identification and semi-quantification of molecules extracted from vegetative tomato plant residues with sustainable green alternative solvents using vacuum-assisted soxhlet and solid-liquid extraction to evaluate the possibilities for high-value applications. To identify compounds, GC-MS analysis, and the Folin-Cioalteau method was used. In sum, 285 different compounds have been assigned to 383 detected peaks using GC-MS analysis. The solvents 2-MTHF and ethyl acetate, compared to ethanol and hexane, provided better results with a maximum number of 99 ± 8.83 compounds, a maximum total concentration of 5,894.82 ± 586.48 and 3,363.02 ± 71.14 mg NEQ kgdw-1 and a total phenolic content of 2,143.25 ± 155.17 and 1,605.92 ± 66.46 mg GAE kgdw-1, respectively. With 781.2 ± 112.66 and 718.25 ± 54.89 mg NEQ kgdw-1 the compound neophytadiene was the most common terpene in ethyl acetate and 2-MTHF extracts, respectively. It can be concluded that vegetative tomato plant residues contain a high variety of bioactive molecules. Green solvents, such as 2-MTHF and ethyl acetate, enhance the extraction of these molecules from the solid matrix.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Ice accumulation poses considerable challenges in transportation, notably in the domain of general aviation. The present study combines the strengths and limitations of conventional aircraft de-icing techniques with the emerging trend toward all-electric aircraft. The study aims to utilize laser-induced graphene (LIG) technology to create a multifunctional surface, seamlessly integrating hydrophobic properties with efficient electrical heating to mitigate surface icing effectively. We investigated the utilization of a 10.6 μm CO2 laser for direct writing on polyimide (PI), a widely-used insulating encapsulation material. From the thermomechanical perspective, our initial analysis using COMSOL Multiphysics software revealed that when the laser power P exceeds 5 W, the PI substrate experience ablative damage. The experimental results show that when P ≤ 5W, an increase in power has a positive impact on the quality, surface porosity, roughness reduction, line-spacing reduction, and water contact-angle enhancement of the graphene. Conversely, when P > 5 W, higher power negatively affects both the substrate and the graphene structure by inducing excessive ablation. However, it influences the graphene line height positively and is consistent with overall experimental-simulation congruence. Furthermore, the incorporation of high-quality graphene resulted in a surface that exhibited higher contact angles (CA > 120°), lower energy consumption, and higher heating efficiency compared to the use of traditional electrically heated materials for anti-icing applications. The potential applications of this one-step fabrication method extend across various industries, particularly aviation, marine engineering, and other ice-prone domains. Moreover, the method has extensive prospects for addressing pivotal challenges associated with ice formation and serves an innovative and efficient anti-icing technology.

The use of privileged scaffolds as starting point for the construction of libraries of bioactive compounds is a widely used strategy in drug discovery and development. Scaffold decoration, morphing and hopping are additional techniques that allow to modify the privileged framework chosen and better explore the chemical space around it. In this study, two series of highly functionalized pyrimidine and pyridine derivatives were synthesized by scaffold morphing approach of triazine compounds obtained previously as antiviral agents. Newly synthesized azines were evaluated against lymphoma, hepatocarcinoma, and colon epithelial carcinoma cells showing in five cases acceptable to good anticancer activity associated to low cytotoxicity on healthy fibroblasts. Finally, ADME in vitro studies were conducted on the best derivatives of the two series showing good passive permeability and resistance to metabolic degradation.

The timely diagnosis of defects at their incipient stage of formation is crucial to extend the life-cycle of technical appliances. This is the case of mechanical-related stress, either due to long aging degradation processes (e.g., corrosion) or in-operation forces (e.g., impact events), which might provoke detrimental damages, such as cracks, disbonding or delaminations, most commonly followed by the release of acoustic energy. The localization of these sources can be successfully fulfilled via adoption of Acoustic Emission (AE)-based inspection techniques through the computation of the Time of Arrival (ToA), namely the time at which the induced mechanical wave released at the occurrence of the acoustic event arrives to the acquisition unit. However, the accurate estimation of the ToA may be hampered by poor Signal-to-Noise ratios (SNRs). In these conditions, standard statistical methods typically fail. In this work, two alternative Deep Learning methods are proposed for ToA retrieval, namely a Dilated Convolutional Neural Network (DilCNN) and a Capsule Neural Network for ToA (CapsToA). These methods have the additional benefit of being portable on resource-constrained microprocessors. Their performance has been extensively studied on both synthetic and experimental data, focusing on the problem of ToA identification for the case of a metallic plate. Results show that the two novel methods can achieve localization errors which are up to 70% more precise than those yielded by conventional strategies, even when the SNR is severely compromised (i.e., down to 2 dB). Moreover, DilCNN and CapsNet have been implemented in a tiny machine learning environment and then deployed on microcontroller units, showing a negligible loss of performance with respect to offline realizations.

The samples from lunar farside have great significance for the study of the Moon, and even the solar system. Chang’e-6 landed successfully on the southern mare of the Apollo basin and returned ~2 kg samples from lunar farside. To provide a better understanding for the background of the returned samples, we conducted detailed crater size-frequency distribution (CSFD) measurements in the Chang’e-6 landing region, the southern mare of the Apollo basin. The southern mare is divided into western mare (W region) and eastern mare (E region), and then subdivided into five sub-units (W1, W2, W3, W4, W5) and three units (E1, E2, E3), respectively, according to the elevation, Ti and Fe abundances. Within the W2 and W5 region, more detailed sub-units were divided. The results show that the southern mare generally have two epochs, one of the Imbrian period and the other of the Eratothenian period. The basalt eruption lasted for ~1.7 Ga, from 3.28 Ga of the eastern mare to 1.54 Ga of the western mare. W region is younger than E region, while the three units of E region has an age of ~3.2 Ga. The ages of the western mare basalts range from 2.98 Ga to 1.54 Ga, lasting for 1.4 Ga. It’s worth noting that the age of the basalt at the Chang’e-6 sampling site is ~1.68 Ga, indicating the samples returned may include components with this very young age.

The lack of defect image data is one of the main factors affecting the accuracy of supervised deep learning-based defect detection models. In response to the insufficient training data of defect images with complex backgrounds such as rust and surface oil leakage in substation equipment, leading to poor performance of the detection model, this paper proposed a novel adversarial deep learning model for substation defect generation: ADD-GAN. In comparison to existing generative adversarial networks, this model generates defect images based on effectively segmented local areas of substation equipment images, avoiding image distortion caused by global style changes. Additionally, the model utilizes a joint discriminator for overall image and defect image to address the issue of low attention to local defect areas, thereby improving the loss of image features. This enhances the overall quality of generated images as well as locally generated defect images, ultimately improving image realism. Experimental results demonstrate that the YOLOV7 object detection model trained on the dataset generated using the ADD-GAN method achieves an mAP of 81.5% on the test dataset, representing an improvement of 9.6% over the original dataset, 5.7% over traditional augmentation methods, and 7% over typical adversarial deep learning methods. This confirms that the ADD-GAN method can generate a high-fidelity dataset of substation equipment defects.

Building defects are very prevalent and contribute significantly to a building's economic value. There are numerous information sources on building defects that have a lot potential for learning more about building defects. This study aimed to identify the information sources used in previous building defect studies and to identify the motivation for carrying out such studies. To fulfil this aim a scoping study was carried out. The information sources identified included insurance companies, private databases, questionnaire surveys, lawsuits, building surveys, client complaint forms, and maintenance reports. This study found that insurance company and client complaint forms include the largest collection of real building defect cases, but such databases may lack detailed descriptions of the causes of the defects. The main purposes of building defects studies identified here included design challenges, identification of defects, building maintenance management, quality management, systematization in data collection, providing an overview of typical defects, and classifying defects. Identification was found to be the most common purpose, indicating that the industry wants to learn more. This study identified research gaps in the climate perspective in relation to building defects. Most of the studies focused on the economical perspective, and none focused on the carbon footprint perspective.

In Taiwan, peanuts are classified by hand. The kernel quality is judged based on the appearance of peanuts. The identification takes considerable time and labor. Fatigue can induce misrecogni-tion or grade cognition instability due. Peanut defects are generally divided into health, underde-velopment, insect bite, and rupture. This study employed two imaging methods push-boom FX10 and Snapshot. Deep learning was used to detect peanut defects. A push-broom instrument was used for testing. There were 1,560 peanuts, including 240 good and 240 bad ones. There were a total of 1,080 good peanuts and bad peanuts in the test set data, the band selection was used, and a CNN model was built. Based on the results from three methods, 3DCNN could classify with 97%accuracy. The Snapshot was used to achieve the real-time design of a lightweight CNN model. Finally, five bands were selected using PCA, and the screening could be accurate and efficient. The maximum overall accuracy was about 98.5%. Kappa was 97.3% with real-time recognition. This will be a major advantage in the future practical application and commercialization processes. This technique can reduce labor costs, achieve intelligent detection and intelligent grading, and bring breakthroughs to smart agriculture for other crops as well.

In order to reach the theoretical efficiency limits of lead-based metal halide perovskite solar cells, the voltage should be enhanced because it suffers from nonradiative recombination. Perovskite materials contain intrinsic defects that can act as Shockley-Read-Hall recombination centers. Several experimental and computational studies have characterized such defect states within the band gap. We give a systematic overview of compositional engineering by distinguishing the different defect reducing mechanisms. Doping effects are divided into influences on: (1) Crystallization; (2) Lattice properties. Incorporation of dopant influences the lattice properties by: (a) Lattice strain relaxation; (b) Chemical bonding enhancement; (c) Band gap tuning. The intrinsic lattice strain in undoped perovskite was shown to induce vacancy formation. The incorporation of smaller ions, such as Cl, F and Cd, increases the energy for vacancy formation. Zn doping is reported to induce strain relaxation but also to enhance the chemical bonding. The combination of computational studies using (DFT) calculations quantifying and qualifying the defect reducing propensities of different dopants with experimental studies is essential for deeper understanding and unraveling insights, such as the dynamics of iodine vacancies and the photochemistry of the iodine interstitials, and can eventually lead to a more rational approach in the search for optimal photovoltaic materials.

Banana wilt caused by Fusarium oxysporum f. sp. cubense tropical race 4 (Foc TR4) is a devastating fungal disease. Biocontrol strategies owned immense potential in inhibiting the spread of Foc TR4. Here, thirty actinobacteria were isolated from soils and screened for their antagonistic activity against Foc TR4. Strain SCA4-21T exhibited broad-spectrum antifungal activity against nine phytopathogenic fungi including Foc TR4. The strain was identified as the genus Streptomyces according to phenotypic characteristics and 16S rRNA gene phylogenetic analysis. Multi-locus sequence analysis based on five house-keeping gene alleles (atpD, gyrB, recA, rpoB, and trpB) revealed that strain SCA4-21T clustered into S. hygroscopicus subsp. hygroscopicus NBRC 13472T with 100% of bootstrap value. Average nucleotide identity and dDDH were 98.49% and 44.30% above the threshold of novel species. Hence, strain SCA 4-21T represented a novel species within the genus Streptomyces, named as Streptomyces luomodiensis sp. nov.. The type strain is SCA4-21T (=GDMCC4.340T= JCM36555T). By the CAZymes analysis, 348 carbohydrate-active enzymes were detected, including 15 chitinases and 8 β-1,3-glucanases. The fermentation broth of strain SCA4-21T showed high activities of chitinase and β-1,3-glucanase, contributing to the antifungal activity. Our results showed an innovative potential biocontrol agent for managing plant fungal diseases, specifically banana fusarium wilt.

The superconductivity of CaC6 as a function of pressure and of abundant Ca isotopes is revisited using DFT calculations on a 2c – double hexagonal superlattice. The introduction of superlattices is motivated by previous synchrotron absorption and Raman spectroscopy results on other superconductors that show evidence of superlattice vibrations at low (THz) frequencies. A 2c superlattice for CaC6 is illustrative of atomic orbital symmetry and periodicity, including bonding and antibonding s-orbital character implied by cosine modulated electronic bands. Inspection of the cosine band reveals that the cosine function has a small (meV) energy difference between bonding and antibonding regions relative to a midpoint non-bonding energy. Fermi surface nesting is apparent in an appropriately folded Fermi surface using a superlattice construct. Nesting relationships identify phonon vectors for conservation of energy and for phase coherency between coupled electrons at opposite sides of the Fermi surface. Detailed analysis of this Fermi surface nesting provides accurate estimates of the superconducting gaps for CaC6 with change in applied pressure. Recognition of superlattices within a rhombohedral or hexagonal representation provides consistent mechanistic insight on superconductivity and electron−phonon coupling in CaC6.

Apis mellifera, especially weak ones, are highly vulnerable to Carpoglyphus lactis mites, which can rapidly infest and consume stored pollen, leading to weakened colonies and potentially colony collapse. This study aimed to ascertain and investigate the prevalence of this mite in honeybee colonies across 9 provinces in the Republic of Korea (ROK). A total of 615 honeybee colonies were collected, from 66 apiaries during the spring and 58 apiaries during the summer of 2023. A 1,242 bp segment of the the Cytochrome c oxidase subunit 1 (COI) gene was amplified using the polymerase chain reaction method. The detection levels of C. lactis in the honeybees were compared between winter and summer. Based on the COI sequence analysis, the nucleotide sequence similarity of C. lactis mites isolated in the ROK with those from China (NC048990.1) was found to be 99.5%, and with those from the United Kingdom (KY922482.1) was 99.3%. This study is the first report of C. lactis in Korean apiaries. The findings in this study demonstrate a significantly higher detection rate in winter, which is 4.1 times greater than that in summer (p < 0.001). Furthermore, the results underscore the usefulness of molecular diagnostic techniques for detecting C. lactis mites.

Viral contamination in the aquaculture industry is a significant challenge that requires further research. Emerging evidence suggests that long noncoding RNAs (lncRNAs) play a role in regulating various biological processes, including immunity. However, most studies have focused on model organisms, and little is known about non-coding RNAs in the immune response to viral hemorrhagic septicemia (VHS) in rainbow trout. In this study, we investigated the listing of non-coding RNAs (ncRNAs) in rainbow trout challenged with VHS virus. We explored their potential role in defense-like responses based on transcriptomic analysis of the virus-treated and control groups. As a result of this research, 4207 lncRNAs were identified, of which 182 lncRNAs were differentially expressed between treated and untreated samples. Among 7753 lncRNA transcripts, 1920 were novel intergenic (class code “u”), and 3748 transcripts were potentially novel isoform of lncRNAs. Gene ontology analysis revealed biological pathways associated with the stress response and immune signaling. Pairs of genes such as TP63-MSTRG.62, IL10-MSTRG.9783, IL10-MSTRG.9784, TK1-MSTRG.22826, and MSTRG.17881-GLI1 showed cis interactions, while DOCK10-MSTRG.30015, MSTRG.36357-LOC101268921, and MSTRG.34190-ENPP2 showed trans interactions. In this study, the role of lncRNAs in regulating the expression of the target genes was clearly identified. This finding is consistent with the regulatory processes of immune system responses mediated by cytokines, as well as the regulation of oxygen levels in response to viral infection. The information presented here highlights the various regulatory mechanisms of lncRNAs in the expression of immune system genes in fish treated with VHS virus.

Based on the detailed exploration of AI techniques for the early identification of learning difficulties in education, this study underscores the pivotal role of educational data analysis in enhancing student outcomes. Educators can proactively identify and address learning challenges through systematic data collection and analysis, thereby minimizing long-term academic obstacles and emotional stress. The integration of AI, particularly through natural language processing and computer vision technologies, facilitates personalized learning paths and real-time interventions, offering tailored support that maximizes each student's learning potential. These advancements optimize educational resource allocation and foster a more inclusive and effective learning environment, paving the way for future advancements in personalized education and intelligent teaching practices.

In the case of a Cu-Mo-W polymetallic ore, the wastewater from the scheelite cleaning flowsheet contains large amounts of residual flocculants and metal ions, and the separation of chalcopyrite and molybdenite require a large number of environmentally harmful depressants. Therefore, it is necessary to find new methods to reduce the environmental and cost pressures of wastewater treatment and the use of depressants. In this work, the flotation wastewater from scheelite cleaning flowsheet for the separation of chalcopyrite and molybdenite by selective surface passivation was investigated for the first time. Flotations of single minerals and artificially mixed minerals with or without immersion pretreatment in the presence and absence of aeration were performed. The results showed that pulp pH had no effect on the flotation of either mineral, and a molybdenite recovery of 93.22% with chalcopyrite recovery of 10.77% was achieved under the conditions of 10 days of immersion pretreatment with aeration, 350 mg/L of kerosene, and 100 mg/L of MIBC. By combining the electrochemical cyclic voltammetry analysis and characterization by XRD and SEM, the selective surface passivation mechanism of chalcopyrite was discussed, which could be due to the coverage of the insoluble oxidation products, especially jarosite. This work has simultaneously achieved the depressant-free flotation separation of molybdenite and chalcopyrite and the reuse of scheelite flotation wastewater, which is of great significance for environmental protection and cost saving.

We aimed to investigate the relationship between membrane material and development of membrane fouling in a membrane bioreactor (MBR) using membranes with different pore sizes and hydrophilicities. Batch filtration tests were performed using submerged single hollow fiber membrane ultrafiltration (UF) modules with different polymeric membrane materials including cellulose acetate (CA), polyethersulfone (PES), and polyvinylidene fluoride (PVDF) with activated sludge taken from a municipal wastewater treatment plant. The three UF hollow fiber membranes were prepared by a non-solvent-induced phase separation method and had similar water permeabilities and pore sizes. The results revealed that transmembrane pressure (TMP) increased more sharply for the hydrophobic PVDF membrane than for the hydrophilic CA membrane in batch filtration tests, even when membranes with similar permeabilities and pore sizes were used. PVDF hollow fiber membranes with smaller pores had greater fouling propensity than those with larger pores. In contrast, CA hollow fiber membranes showed good mitigation of membrane fouling regardless of pore size. The results obtained in this study suggest that the surface hydrophilicity and pore size of UF membranes clearly affect the fouling properties in MBR operation when using activated sludge.

The apicomplexan parasite, Sarcocystis neurona causes the degenerative neurological equine protozoal myeloencephalitis (EPM) disease of horses. Due to its host range expansion, S. neurona is an emerging threat that requires close monitoring. In apicomplexans, protein kinases (PKs) have been implicated in a myriad of critical functions such as host cell invasion, cell cycle progression and host immune responses evasion. Here, we used various bioinformatics methods to define the kinome of S. neurona and phylogenetic relatedness of its PKs to other apicomplexans. Further, three-dimensional (3D) homology models for selected S. neurona putative PKs were constructed and evaluated for inhibitor docking. We identified 92 putative PKs clustering within the AGC, CAMK, CK1, CMGC, STE, TKL, aPK and OPK groups. Although containing the universally conserved PKA (AGC group), S. neurona kinome was devoid of PKB and PKC, but contained the six apicomplexan conserved CDPKs (CAMK group). The OPK group was represented by ROPKs 19A, 27, 30, 33, 35 and 37, but was devoid of the virulence-associated ROPKs 5, 6, 18 and 38. Two out of the three S. neurona CK1 enzymes had high sequence similarities to T. gondii TgCK1-α and TgCK1-β and the Plasmodium PfCK1. Docking of four inhibitors onto homology models of putative ROP27 and PKA indicated that inhibition of S. neurona PKs is feasible, but needs to be experimentally tested. The essentiality of apicomplexan PKs makes the elucidation of S. neurona kinome a key milestone for development of novel therapeutics for EPM.

This study aimed to learn disturbance information to effectively control multiple small unmanned surface vehicles (USVs) for marine research purposes at sea. The learned disturbance information was used to investigate the control of multiple USV swarms based on the leading–following formation technique. Numerous studies have already been conducted on swarm control using drones in the air; however, there has been a paucity of studies on swarm control in the sea. Contrary to swarm control in aviation, the fluid density of the sea is high, and the environment is constantly changing; thus, a robot system would be significantly affected by disturbances. This ultimately influences the maintenance of swarm formations and the accomplishment of missions [1,2]. Therefore, it is difficult to control numerous moving objects while maintaining a formation at sea by using the existing aerial drone swarm control technology. To solve this problem, we learned a long short-term memory (LSTM) model with time-series marine environmental data to predict maritime disturbances. Thereafter, the model was applied to a mission-based position control algorithm of each USV constituting the swarm to design a marine unmanned floating vessel swarm control system that can be applied to various marine environments. Specifically, to effectively control numerous small USVs for marine research purposes, ocean currents are learned using the LSTM algorithm, and the predicted ocean currents are used to generate a swarm USV control system for USV formations. In this study, a control system model of several small USVs equipped with two rear thrusters and a front lateral thruster was designed. The LSTM algorithm was learned using the previous ocean current data, and the velocity of the following ocean currents was predicted. The predictions were then used as a system disturbance to determine the thrust of the controller. To measure ocean currents in the sea when each USV moves, the velocity, azimuth, and position (latitude, longitude) data from the GPS mounted on the USV were used to measure the velocity and direction of the hull's movement. Further, the flow rate was measured using a flow rate sensor on a small USV. The USV movement and position were controlled using an artificial neural network-PID (ANN-PID) controller. This study entailed a comparative analysis of the designed USV model results and those generated by the simulator, including the behavior control rule of the USV swarm and the path of the actual USV swarm at sea. It was verified that the effectiveness of the USV mathematical model and behavior control rules. By comparing the movement path of the swarm USV with and without the disturbance learning algorithm and ANN-PID control algorithm applied to the designed simulator, the position error and maintenance performance of the swarm formation were analyzed, and the application results were compared.

The detection accuracy of bridge superficial defect using the deep neural network approach decreases significantly under light variation and weak texture condition. To address these issues, an enhanced intelligent detection method based on the YOLOv8 deep neural network is proposed in this study. Firstly, multi-branch coordinate attention (MBCA) is proposed to improve the accuracy of coordinate positioning by introducing a global perception module in coordinate attention mechanism. Furthermore, a deformable convolution based on MBCA is developed to improve the adaptability for complex feature shapes. Lastly, the deformable convolutional network-attention-YOLO (DAC-YOLO) detection algorithm is formed by replacing the deep C2F structure in the YOLOv8 architecture with deformable convolution. A supervised dataset consisting of 4794 bridge surface damage images is employed to verify the proposed method, and results show that it achieves improvements of 2.0% and 3.4% in mAP and R. Meanwhile, the model complexity decreases by 1.2G, increasing the detection speed by 3.5/f·s-1.

Insulin-like Growth Factor 2 mRNA binding Protein 1 (IGF2BP1) is a promising candidate gene for influencing economic traits in livestock and poultry. The second intronic region of IGF2BP1 is closely related to growth traits, although the exact mechanism remains unclear. The preliminary resequencing results of goats in our laboratory demonstrated that the IGF2BP1 gene region was subject to strong selection, then we selected multiple single nucleotide polymorphisms (SNPs) to identify. Seven SNPs were located in the conserved region of the second intron, and their functions and relationship with growth traits require further clarification. This study selected 348 Nanjiang Yellow goats as experimental subjects, and chose Time of Flight Mass Spectrometer (MALDI-TOF) as the main method. Our results showed that six SNPs were significantly correlated with the growth traits of the Nanjiang yellow goat by association analysis. Among them, the rs652062749(A>G) was identified as the primary locus affecting the later stage of growth traits of Nanjiang yellow goat. Moreover, there was a strong linkage among three SNPs, and the rs638185407 (T>A) mutant type was observed to increase the luciferase activity in H293T cells extremely significantly. The TTAACT, TTCCCC, and ATCACT combination genotypes were dominant combination genotypes, which provided theoretical references for further genetic co-breeding. The results of our study demonstrate the potential role of the IGF2BP1 gene as a functional genetic marker in the breeding programs of Nanjiang Yellow goats.

This short report extends our previous paper “Multiplicity of human scent signature” and transfers canine identification to digital processing of data. The question is whether current GCxGC-MS technology and computer-based identification can perform identification as well as canines. This would objectify the identification of persons. Working with digital scent samples enables the use of multiple scent signatures for more exact identification. More differently constructed signatures during the identification process may represent the key point in identification of persons in olfactronics. Several types of scent signatures were considered in this article. The digital scent signatures were constructed based on the relative contents of the chemical compounds in the samples and relative ratios of compounds in the samples. Further on the signatures were made from the parts of the original samples fractioned by the volatility of compounds and by the relative abundance of the compounds in the samples. These results confirm the scent multiplicity phenomenon in digital scent samples. Using differently constructed signatures may be the key point in identification of persons using digital scent samples. This approach enables a transition from subjectivity to objectivity and a change from physical olfactory to olfactronic processing of digital scent samples.

Saikosaponin (SS) a is a compound with various pharmacological properties and easily degraded into SSb1 and SSg in acid condition. In present work another two new degradation products of SSa formed under acid hydrolytic condition were detected and isolated by analytical and semi-preparative liquid chromatography technology, furthermore their structures were characterized as hydroxyl-saikosaponin a and SSb2 by spectral analysis, which is not only essential in stability-indicating method development and validation but also could be used as a worst case to assess the analytical method performance of SSa. Moreover their structural transformation pathways were also proposed.

This research was devoted to study the effect of the tacticity of PMMA on the surface physicochemical properties such as the London dispersive component of the surface energy of the polymer, the polar and dispersive free energies, the Lewis’s acid-base surface parameters, and the Lewis acid and base surface energies of atactic, isotactic and syndiotactic PMMAs as a function of the temperature. Inverse gas chromatography (IGC) at infinite dilution was used to determine the surface thermodynamic properties of PMMA at different tacticities. The experimental values of the net retention time and volume of model organic molecules adsorbed on the atactic, isotactic and syndiotactic PMMAs, were obtained by IGC technique at infinite dilution. The London dispersion interaction energy was used for the separation of the polar and dispersive energy of the different n-alkanes and polar solvents adsorbed on the different PMMA surfaces. The London dispersive surface energy γ_s^d (T) of PMMAs was determined by applying the Hamieh thermal model that took into account the effect of the temperature on the surface area of adsorbed molecules. The obtained results showed non-linear variations of γ_s^d (T) of atactic, isotactic, and syndiotactic PMMAs with three maxima characterizing the three transition temperatures of PMMAs, T_g, T_g and T_(liq-liq) with a shift of these temperatures with the isotactic and syndiotactic PMMAs. It was showed that the polar interaction free energy ∆G_a^p (T) also showed the presence of the three above transition temperatures of the polymers. The study showed an important non-linearity variation of the different acid-base parameters in the various polymer surfaces proving the highest effect of the temperature and the tacticity on these parameters. The determination of the enthalpic and entropic Lewis’s acid-base parameters showed an amphoteric character for the different PMMAs. The basicity of the atactic PMMA was about four times larger than its acidity outside the neighborhood of the transition temperatures of the polymer. Whereas, the isotactic PMMA was about 2 to 2.5 times more basic than acid, while the syndiotactic PMMA exhibited the highest basicity by showing a surface 5 to 8 times more basic than acid. However, the Lewis acid-base parameters strongly depended on the temperature and sudden variations of these surface parameters were observed around the transition temperatures largely depending on the PMMA tacticity. The determination of the polar acid and base surface energies of the three PMMAs led to the same previous transition temperatures with an important effect of the tacticity of PMMA on the values of these acid-base surface energies.

Oral squamous cell carcinoma (OSCC) is a highly prevalent and aggressive malignancy, with mortality rates that reach 60%, mainly due to an excessive diagnostic delay. MiRNAs, a class of crucial epigenetic gene-expression regulators, have emerged as potential diagnostic biomarkers, with >200 molecules reported to be dysregulated in OSCC. We had previously established an in silico methodology for the identification of the most disease-specific molecules by bridging genetics and epigenetics. Here, we identified the stage-specific miRNAs that govern the asymptomatic early stages of oral tumorigenesis by exploiting the reverse interplay between miRNA-levels and their target-genes’ expression. Incorporating gene expression data from our group’s experimental hamster model of sequential oral oncogenesis, we bioinformatically detected the miRNAs that simultaneously target/regulate >75% of the genes that are characteristically upregulated or downregulated in the consecutive stages of hyperplasia, dysplasia and early-invasion OSCC, while exhibiting the opposite expressional dysregulation in OSCC-derived tissue and/or saliva specimens. We found that all stages share the downregulation of miR-34a-5p, miR124-3p, and miR-125b-5p, while miR-1-3p is underexpressed in dysplasia and early-invasion. Malignant early-invasion stage is distinguished by the downregulation of miR-147a and the overexpression of miR-155-5p, miR-423-3p and miR-34a-5p. The identification of stage-specific miRNA molecules may facilitate their utilization as biomarkers for presymptomatic OSCC diagnosis.

Point defects induced by doping rare earth elements RE (Nd, Er) into the magnesium oxide host were investigated by classical atomistic simulations utilising the General Utility Lattice Program (GULP). Formation and association energies were calculated for the potential defect structures. Both isolated defects and defect complexes were considered. The most energetically favourable structures of defect complexes were found for rare earth doped and Li co-doped systems. The correlation between the association energy and the structure of the defect complex was investigated. The influences of Li were revealed with respect to energy and structure. The simulation results contribute to the understanding of the point defects of doped MgO and how Li influences the doping of rare earth elements in the MgO host.

Defect detection plays a pivotal role in quality control for fabrics. In order to enhance the accuracy and efficiency of fabric defect detection, we have proposed the PRC-Light YOLO model for fabric defect detection and have established a detection system. Firstly, we add new convolution operators in Backbone for the YOLOv7 and integrate them with Extended-Efficient Layer Aggregation Network. This combination constructs a new feature extraction module that not only reduces the computational effort of the network model, but also extracts spatial features effectively. Secondly, we employ multi-branch dilated convolutions feature pyramid, and introduce lightweight upsampling operators to improve performance of the feature fusion network. This module achieves an expanded receptive field by generating real-time adaptive convolution kernels, allowing for the collection of crucial information from regions with a richer contextual context. To further minimize the computation during network model training, we adopt the HardSwish activation function. Finally, we apply the Wise-IOU v3 bounding box loss function as a dynamic non-monotonic focusing mechanism, which decreases adverse gradients from low-quality instances. We conduct data augmentation on real fabric dataset to raise the generalization capability of the PRC-Light YOLO model. Compared with the YOLOv7 model, numerous simulation experiments show that our proposed methods reduce the model’s parameters and computation by 18.03% and 20.53%, respectively. Simultaneously, there has been a 7.6% improvement in mAP.

Defect recognition in ballastless track structures, based on distributed acoustic sensors (DASs), was researched in order to improve detection efficiency and ensure the safe operation of trains on high-speed railways. A line in southern China was selected, and equipment was installed and debugged to collect the signals of trains and events along it. Track vibration signals were extracted by identifying a train track, denoising, framing and labeling to build a defect dataset. Time–frequency-domain statistical features, wavelet packet energy spectra and the MFCCs of vibration signals were extracted to form a multi-dimensional vector. An XGBoost model was trained and its accuracy reached 89.34%. A time-domain residual network (ResNet) that would expand the receptive field and test the accuracies obtained from convolution kernels of different sizes was proposed, and its accuracy reached 94.82%. In conclusion, both methods showed good performance with the built dataset. Additionally, the ResNet delivered more effective detection of DAS signals compared to conventional feature engineering methods.

The success of a software system is highly dependent upon its quality which is a very critical aspect and is the ultimate goal to be achieved. Defect Management is the most important process in ensuring software quality, it involves defect detection, defect categorization, defect prioritization, defect removal and defect verification. The main purpose of this process is to develop and produce defect free or least defected software systems of high quality. It plays a vital role in gaining customer confidence and satisfaction which is essential for the reputation of the organization developing the system. The central objective of this study is to explain the importance of defect management and its impact on the quality of the software along with various defect management techniques to support the objective.

This study was conducted to identify the actual degree of underdevelopment and spatial characteristics of rural areas in Korea, which are expected to face extinction due to population decline and aging. For this purpose, the spatial scope was set to Eup and Myeon areas classified as rural regions. To assess the degree of underdevelopment, previous studies were reviewed and analyzed to develop a comprehensive underdevelopment index, which was then applied to Eup and Myeon areas to classify them into growth regions, general regions, and depressed regions. Mapping the classified regions revealed that both growth and general regions were concentrated in the metropolitan area and southeastern regions, where Korea's population and resources are densely clustered. In contrast, depressed regions were found primarily in areas where agriculture is the main industry and in regions with unfavorable geographical conditions. This study is significant as it covers the entire nation of Korea, providing a method for identifying depressed regions and highlighting the regions that are developing. The findings can serve as fundamental data for the development of policies to address population decline in the future.

The objective of person re-identification (ReID) tasks is to match a specific individual across different times, locations, or camera viewpoints. The prevalent issue of occlusion in real-world scenarios affects image information, rendering the affected features unreliable. The difficulty and core challenge lie in how to effectively discern and extract visual features from human images under various complex conditions, including cluttered backgrounds, diverse postures, and the presence of occlusions. Some works have employed pose estimation or human keypoint detection to construct graph-structured information to counteract the effects of occlusions. However, this approach introduces new noise due to issues such as the invisibility of keypoints. Our proposed module, in contrast, does not require the use of additional feature extractors. Our module employs multi-scale graph attention for the reweighting of feature importance. This allows features to concentrate on areas genuinely pertinent to the re-identification task, thereby enhancing the model's robustness against occlusions. To address these problems, a model that employs multi-scale graph attention to re-weight the importance of features is proposed in this study, significantly enhancing the model’s robustness against occlusions. Our experimental results demonstrate that, compared to baseline models, the method proposed herein achieves a notable improvement in mAP on occluded data sets, with increases of 0.5%, 31.5%, and 12.3% in mAP scores.

The infrared (IR) satellite remote sensing of sea surface skin temperature (SSTskin) is challenging in the northern high latitude region, especially in the Arctic because of its extreme environmental conditions, and thus the accuracy of SSTskin retrievals is questionable. Several Saildrone uncrewed surface vehicles were deployed at the Pacific side of the Arctic in 2019, and two of them, SD-1036 and SD-1037, were equipped with a pair of IR pyrometers on the deck whose measurements have been shown to be useful in the derivation of SSTskin with sufficient accuracy for scientific applications, providing an opportunity to validate satellite SSTskin retrievals. This study aims to assess the accuracy of MODIS-retrieved SSTskin from both Aqua and Terra satellites by comparisons with collocated Saildrone-derived SSTskin data. The mean differences in SSTskin from the SD-1036 and SD-1037 measurements are different by ~0.4 K, largely resulting from differences in the atmospheric conditions experienced by the two Saildrones. The performance of MODIS on Aqua and Terra in retrieving SSTskin is comparable. Negative brightness temperature (BT) differences between 11 μm and 12 μm channels are identified as being physically based, but are removed from the analyses as they present anomalous conditions for which the atmospheric correction algorithm is not suited. Overall, the MODIS SSTskin retrievals show negative mean biases, -0.234 K for Aqua and -0.295 K for Terra. The variations in the retrieval inaccuracies show an association with diurnal warming events in the upper ocean from long periods of sunlight in the Arctic. Also contributing to inaccuracies in the retrieval is the surface emissivity effect in BT differences characterized by the Emissivity-introduced BT difference (EΔBT) index. This study demonstrates the characteristics of MODIS-retrieved SSTskin in the Arctic, at least at the Pacific side, and underscores that more in situ SSTskin data at high latitudes are needed for further error identification and algorithm development of IR SSTskin.

Quite a number of cottonseed varieties are existed. The seeds of each variety produce a different amount of gossypol as a natural toxic compound. The increased interest in this natural product and its toxic effects were enhanced the demand for establishing simple silica-gel-based methods for its isolation, purification, and characterization. Historically, silica gel plays a significant role in isolation and purification of many different natural products. Silica gel is variants and can intro-duce a lab, simple tool for tracking a compound in certain plants during its purification process. In this study, gossypol was isolated and purified in the form of yellow crystals as gossypol acetic ac-id. Several methods and tools were used for its characterization including TLC, preparative TLC, silica gel column, UV/IR spectrophotometer and HPLC (Robust spherical silica gel). A compara-tive study between its amounts in both Egyptian and Chinese varieties were performed. Under the experimental condition, the Egyptian cottonseeds contain 8.705 gm/kg, while the Chinese contains 5.395 gm/kg. Thin Layer Chromatography (TLC) had been flourished the science of the phytochemistry and still popular till nowadays and is recommended for fast, accurate, and inex-pensive evaluation and quantification of gossypol. It is recommended to isolate and purify gossy-pol as gossypol acetic acid using optimized combined methods used in this study. Using Silica gel different protocols will assist and facilitate the parallel comparison and save the compact column from any unexpected contaminants during the purification steps. During each step the silica gel itself could be simply removed by paper filtration.

Salt stress is a major limiting factor for alfalfa yield due to its relatively low salt tolerance. High soil salinity adversely impacts alfalfa growth and development, leading to reduced yield. Melatonin (MT) is known to play a significant role in enhancing plant resistance to abiotic stresses. However, the mechanisms underlying melatonin-mediated abiotic stress responses, particularly salt stress, are not well understood. To address this gap, we conducted a study focusing on germinating alfalfa seeds under salt stress. Physiological indexes and transcriptomics analyses were carried out on the germinated seeds to investigate the effects of melatonin on alfalfa seedlings under salt stress conditions. Our results revealed that the application of melatonin led to an increase in shoot length and fresh weight of alfalfa seedlings under salt stress. Moreover, key physiological indexes such as peroxidase (POD) activity and glutathione (GSH) content were enhanced, while levels of malondialdehyde and superoxide anions decreased. Transcriptomic analysis identified a total of 2,131 differentially expressed genes in the salt-treated group, with 726 up-regulated and 1,405 down-regulated genes, while the MT-treated group showed 2896 differentially expressed genes, of which 1,097 were up-regulated and 1,799 were down-regulated. Further, KEGG enrichment analysis highlighted the enrichment of differentially expressed genes in pathways including flavonoid biosynthesis, ABC transporter, glutathione metabolism, and the MAPK signaling pathway, with these pathways more significantly enriched in the MT-treated group. These findings collectively suggest that melatonin plays a crucial role in alfalfa's response to salt stress and offer new insights into the genomic mechanisms underlying melatonin-mediated salt tolerance in alfalfa.

Titanium alloys belong to the metal biomaterials that are one of the most widely used in medicine. In recent years, in order to reduce the use of vanadium, Ti6Al4V alloy is increasingly replaced by Ti6Al7Nb alloy. In addition, to ensure the best possible biocompatibility, its surface is subjected to appropriate modifications, for example, anodic oxidation. Despite the extensive use of anodic oxidation of titanium implants in orthopedics, there are few works focused on a detailed analysis of the chemical composition of the surface layers. In addition, the effect of treatments before anodic oxidation on the properties of the produced layer has not been analyzed. Thus, the purpose of this study was to analyze in detail the chemical composition of the passive layer of Ti6Al7Nb alloy obtained by anodic oxidation preceded by sandblasting. Moreover, the physicochemical properties of the analyzed surface affecting biocompatibility were determined. For this purpose, surface observation, wettability and roughness tests, microhardness tests, electrochemical tests and phase composition analysis were carried out. In addition, the preclinical suitability, of the surface modified in this way, was evaluated by cytotoxicity tests.

Brazil has ideal conditions for the large-scale use of cabotage cargo transportation: a vast coastline with almost 7,400 km, approximately 70% of the population resident in a coastal range of up to 200 km from the coast and a strong concentration of activities economic along the coast. However, there is an absolute domain of road modal for the transportation of goods, and cabotage is underused. The purpose of the study was to raise the main barriers that negatively impact the performance of Brazilian cabotage. To this end, it was used to bibliographic and documentary research, based on studies already published in journals, doctoral theses, master's dissertations, congress annals, technical reports and research on government-related government agencies sites, navigation companies and entities related to cabotage. The main barriers that contribute to the low use of cabotage in Brazil were identified and analyzed, as well as possible alternatives of solution for sustainable development of this mode of transport. Such a study will certainly serve as subsidies for the definition of public policies aimed at better use of Brazilian cabotage, as well as to encourage navigation companies to invest more in the transport of goods by cabotage, in order to contribute to the reduction of trucks on highways Brazilian and for environmental preservation.

The AREB/ABF (ABA response element binding) proteins in plants are vital for plant stress responses, but the understanding of AREB/ABFs in orchid species, an important traditional medicinal and ornamental plants, is limited. Here, twelve AREB/ABF genes were identified within three orchids’ complete genome and classified into three groups (groups I, II, and III) via a phylogenetic analysis, which was further supported by the analysis of their conserved motifs and gene structures. The cis-elements analysis showed that hormone response elements followed by light and stress responses were widely rich in AREB/ABFs. A prediction analysis of orchid ABRE/ABF-mediated regulatory network was further constructed through cis-regulatory elements (CREs) analysis of their promoter regions and revealed that several transcriptional factor (TF) gene family were abundant as the potential regulators for orchid AREB/ABFs. Expression profile analysis based on public transcriptomic data showed that most AREB/ABF genes have distinct tissue-specific expression patterns in orchid plants. Additionally, DcaABI5 as the homolog of ABA INSENSITIVE 5 (ABI5) from Arabidopsis was selected for further analysis. The results showed that Arabidopsis transgenic overexpressing DcaABI5 could rescue the ABA insensitive phenotype in the mutant abi5. Collectively, these findings will provide valuable information on AREB/ABF genes in orchids.

In this article, we describe a simple procedure for evaluating the sterility of nutrient media using a shear-horizontal surface acoustic wave (SH-SAW) biosensor. We used the SH-SAW biosensor platform to monitor the time-dependent phase responses of the material for the media that binds to a monolayer of 3-mercaptopropanyl-N-hydroxy succinimide on the biosensor surface. Increases in the phase shift less than 50% of the starting phase shift recorded 180 minutes after the sterilization indicate a successful sterility test of the media. Our devices were then applied to sterility testing using a viable Escherichia coli (E. coli) K-12 solution to confirm our hypothesis. Filtered LB Broth was the negative control, and a 24-hour culture of E. coli was the positive control. Before testing, the cell solution was pelleted, the media decanted, and then replaced with a 1x phosphate-buffered saline solution (1x PBS). Since we know that the N-hydroxysuccinimide residues will bind to amine groups, only in cases where microbial species are present will the surface binding increase greater than 50%. We confirmed our hypothesis using SH-SAW biosensors and overnight E. coli cultures. The sensitivity for our 250 MHz quartz SH-SAW sensors was calculated based on the response from the E. coli K-12 solution over the linear dynamic range, which appears to be 2x10^4 – 2x10^7 CFU per ml and has a sensitivity of S = 1.655x10^5 o m2 Kg-1. The limit of detection (LOD) for these sensors was calculated to be approximately 2x10^-9 grams (g), which is estimated to be approximately 2,000 Escherichia coli (E. coli) K-12 cells. However, the sensitivity and insertion loss remained approximately unchanged before and after coating the sensor with 3,3'-Dithiobis(succinimidyl) Propionate (DSP).

To achieve real-time identification of soybean seedlings and weeds in soybean seedling fields on agricultural intelligent terminal devices, this article constructs a real-time evolutionary identification system ESWIM driven by computational complexity under few-shot training. Firstly, based on the identification task, high-quality image samples are collected and annotated. By analyzing the terrain, the weather during the growth period, image acquisition methods, and the status of equipment fieldwork, we obtained a suitable enhancement algorithm. This algorithm not only effectively simulates the diversity of actual images, but also solves the problem of significant imbalance in the number of targets. Then, using the computational complexity driven approach and YOLOv5n as the foundation model, a soybean seedling and weed recognition model SWIM is constructed. The model's computational space and time complexity are reduced by 45.19% and 42.86%, respectively, while mAP (0.5) increased by 0.1%. Finally, by utilizing human-computer interaction to enable real-time and effective evolution of the dataset, an evolutionary strategy is designed to rapidly iterate and update model parameters, resulting in the development of the evolutionary system ESWIM. Laboratory experiments have shown that the ESWIM system can quickly adjust the recognition system during device operation to achieve target identification tasks in different environments.

The present study investigates the impact of electrode surface roughness on the electrofreezing of water. This research focuses on how the electrode roughness induced by a laser treatment affects the nucleation and growth of ice crystals under controlled electric fields. To achieve this, a series of experiments were conducted using deionized water samples placed between electrodes with varying surface roughness. The electrodes, fabricated with the Al6061 T6 alloy were structured via the Laser Shock Processing (LSP) method. For this purpose, the pulsed densities during the LSP process were varied from 900 to 2500 pulses/cm2. The increase of the pulse density was correlated to the surface structuring and to the microstructural features and average roughness of the LSP-treated Al6061 alloy. A wavy-like microstructure was induced upon the LSP treatment with average roughnesses between ~ 3.5 and 6 µm at the selected pulse densities. The results indicate that electrode roughness significantly influences the electrofreezing process. Rougher electrodes were found to lower the nucleation temperature compared to smoother ones, suggesting enhanced ice nucleation activity. The findings are attributed to the increased electric field concentration at the asperities of the rough surfaces, which may facilitate the alignment of water molecules and the formation of critical ice nuclei.

Software is increasingly vital, with automated systems regulating critical functions. As development demands grow, manual code review becomes more challenging, often making testing more time-consuming than development. A promising approach to improving defect detection at the source code level is the use of artificial intelligence combined with natural language processing (NLP). Source code analysis, leveraging machine-readable instructions, is an effective method for enhancing defect detection and error prevention. This work explores source code analysis through NLP and machine learning, comparing classical and emerging error detection methods. To optimize classifier performance, metaheuristic optimizers are used, and a modified algorithm is introduced to meet the study’s specific needs. The proposed two-tier framework uses a convolutional neural network (CNN) in the first layer to handle large feature spaces, with AdaBoost and XGBoost classifiers in the second layer to improve error identification. Additional experiments using Term Frequency-Inverse Document Frequency (TF-IDF) encoding in the second layer demonstrate the framework’s versatility. Across five experiments with public datasets, the CNN achieved an accuracy of 0.768799. The second layer, using AdaBoost and XGBoost, further improved these results to 0.772166 and 0.771044, respectively. Applying NLP techniques yielded exceptional accuracies of 0.979781 and 0.983893 from the AdaBoost and XGBoost optimizers.

Following technological advances, autonomous and remote-controlled ships are performing trials in some sea areas; a mandatory goal-based MASS code, expected to enter into force on 1 January 2032, is under discussion in the International Maritime Organization (IMO). However, there are no unified standards regarding verification methods to define operating limitations for cutting-edge technologies, which are expected to be elements of MASS, so it is difficult to assess the risk factors for the management and operation of MASS. This paper outlines the regulatory framework for MASS, followed by a discussion of its application, considering the differences between MASS and automated driving, and how to develop safety management and operation using standards for automated driving. A requirements management framework developed as a system and software engineering standards to build safety management and operation of MASS is proposed. It is also suggested that the requirements management framework could be used not only for MASS development but also for regulatory review from a requirements management view.

Water quality assessment in pastoral of Tibetan Plateau, which is water sources for about 40% of world's population and the runoff-yield area of Yellow rivers, is very important. In this paper, Xiahe county which belongs to Tibetan Plateau pastoral was investigated. Six parameters(via, chloride, COD, ammonia nitrogen, nitrate, fluoride, sulfate) were selected to assess the water quality and health degree by using fuzzy comprehensive evaluation methods. The hydrochemical type in surface water was of HCO3--Mg2+-Ca2+ type. The cations and anions in surface water were mainly from weathering and dissolution of carbonate rock. Results showed that the water quality in all 69 sampling sites was all of class Ⅰ. The integrated health degree reached more than 0.85 and the health rate were 100%. Although ammonia nitrogen was regarded as the main contamination factor, but it had a little effect on the entire body of water. Overall, the surface water qualities of most samples in Xiahe County was good condition.

The study of the pathogenesis of febrile seizures and their consequences frequently necessitates gene expression analysis. The primary methodology employed for such analysis is reverse transcription with quantitative polymerase chain reaction (RT-qPCR). To guarantee the accuracy of data obtained by RT-qPCR, it is crucial to utilize stably expressed reference genes. The objective of this study was to identify the most suitable reference genes for use in the analysis of mRNA production in various brain regions of rats following prolonged neonatal febrile seizures. The expression stability of eight housekeeping genes was evaluated using the online tool RefFinder in the dorsal and ventral hippocampal regions and in the temporal and medial prefrontal cortex of the brain. The Ppia gene exhibited the greatest stability of expression. Conversely, the genes with the least stable expression level are Actb and Ywhaz; thus, it is not recommended to use them for normalization in a febrile seizure model. Additionally, the majority of housekeeping genes demonstrate age-related, region-specific fluctuations. Therefore, it is crucial to employ the appropriate housekeeping genes for each brain structure under investigation when examining the expression dynamics of genes of interest in a febrile seizure model.

For many engineering applications it is sufficient to use the concept of simple materials. However, higher gradients of the kinematic variables are taken into account to model materials with internal length scales as well as to describe localization effects using gradient theories in finite plasticity or fluid mechanics. In many approaches length scale parameter have been introduced that are related to a specific micro structure. An alternative approach is possible, if a thermodynamically consistent framework is used for material modelling as shown in the present contribution. However, even if sophisticated and thermodynamically consistent material models can be established there are still not yet standard experiments to determine higher order material constants. In order to contribute to this ongoing discussion system identification based on the method of self-adaptive filtering is proposed in this paper. To evaluate the effectiveness of this approach it has been applied to second-order gradient materials considering longitudinal vibrations. Based on thermodynamically consistent models that have been solved numerically it has been possible to prove that system identification based on self-adaptive filtering can be used effectively for both narrow-band and broadband signals in the field of second-order gradient materials. It has also been found that the differences identified for simple materials and gradient materials allow for condition monitoring and detection of gradient effects in the material behavior.

Groundnut is an oil seed cash crop, that can be consumed directly by humans and animals. It is also used as an intelligence in the industrial production of butter and other products. However, Groundnut seeds can become infected with fungi, viruses, pests, physical damage, and high heat, which can negatively impact crop yield, quality, and economic value, and pose health hazards. To address these challenges, computer vision technology detects and classifies defects. This study introduced an ensemble deep learning defected classification model that combines VGG16 and InceptionV3 using seed images. To enhance model performance, collected images are preprocessed using novel techniques tailored to different image types. Preprocessing techniques are chosen based on image-quality evaluation metrics. Watershed segmentation is applied followed by detecting the region of interest in the image using YOLOv3. The image dataset is augmented and balanced using a Generative Adversarial Network (GAN). The model development involves a combination of classical and deep-based features, comparing features extracted with (HOG and GLCM) to those extracted with InceptionV3 and VGG16. The ensemble model achieves an accuracy of 96.25% with a split ratio of 10% for testing, 10% for validation, and 80% for training set. This research benefits farmers looking to improve yield, consumers of groundnut products, and researchers studying seed defects. The work provides valid insights for future researchers regarding dataset creation, augmentation, methods, and feature selection for modeling. However, the model experienced misclassifications due to the similar appearance of sample images in different classes. Future researchers should address these challenges and consider factors such as oil content and defect grading.

We have developed circular defects in 2-dimensional photonic crystal lasers that allow current injection for interconnected optical communications. However, when cleaving the sample to measure the output light, the output light intensity changes due to the cleaving position. In a previous study, we discovered through simulation that this effect could be eliminated and that a higher optical output might be obtained by applying a convex edge structure. In this paper, we develop the fabrication technology for this structure, fabricate samples, and measure the output light experimentally. Room-temperature continuous-wave laser oscillations using this structure are observed. The laser threshold is similar to well-lasing samples with normal cleavage edge faces. We are assured that these results contribute to future work such as accurate manufacturing and improving the end-face configuration to obtain higher outputs.

Mango (Mangifera indica L.) is an allotetraploid (2n = 4X= 40) drupe fruit and has high nutritional value belongs to genus Mangifera and family Anacardiaceae. Mango cultivars are used with worldwide acceptance to pharmacological, ethnomedical, and phytochemical industries. Assessment of the genetic distinctiveness of a cultivar through morphological descriptors is an important tool for both the registration and the protection. New mango genotypes have been improved using valuable diverse germplasm resources to ensure food security. DNA fingerprinting based simple sequence repeats (SSR)-markers have been the most broadly used, effective and accurate in evaluation of genetic characterization of a cultivar. Molecular breeding is an effective source of genetic gain after improvement of fruit trees using marker assisted genomic selection. Total genomic DNA (gDNA) was generated using CTAB method from each cultivar. The most effective 50 hyper-variable SSR markers were selected. Highly specific DNA fingerprints were identified in the candidate line ‘Azeem Chaunsa’ compared with three standard cultivars using SSR-PCR. An agglomerative hierarchical clustering method was used to construct dendrogram based on the UPGMA clustering method. Cultivar identification diagram (CID) was constructed to evaluate association among standard cultivars and Azeem Chaunsa. Our results showed that SSR markers could efficiently assess genetic diversity in mango. The genetic similarity coefficients were recorded between the cultivars of mango ranged from 0.49 to 0.67. CID results concluded that cultivar ‘Azeem Chaunsa’ varied significantly from the check cultivar, Sindhri (46.2%), S.B Chaunsa (45%) and Sufaid Chaunsa (46.7%). The results obtained in this study will orient cultivar identification strategies for a successful future.

Surface initiated atom transfer radical polymerization (SI-ATRP) is one of the most versatile technique to modify the surface properties of material. Recent developed metal free SI-ATRP makes such technique more widely applicable. Herein photo-induced metal-free SI-ATRP of methacrylates, such as methyl methacrylate, N-isopropanyl acrylamide, and N,N- dimethylaminoethyl methacrylate, on the surface of SBA-15 was reported to fabricate organic-inorganic hybrid materials. SBA-15 based polymeric composite with adjustable graft ratio was obtained. The structure evolution during the SI-ATRP modification of SBA-15 was monitored and verified by FT-IR, XPS, TGA, BET, and TEM. The obtained polymeric composite showed enhanced adsorption ability for the model compound toluene in aqueous. This procedure provides a low cost, ready availability, and facile modification way to synthesize the polymeric composites without the contamination of metal.

In this paper, an adaptive proportional and integral (PI) controller for speed control of electric drives is developed. The adaptive PI controller is designed based on model reference adaptive identification and the Lyapunov function so that the system stability can be proved. To identify the inertia, the viscous friction torque coefficient, and the load torque simultaneously and smoothly, sinusoidal speed reference is usually employed. A modified motion equation considering the low-pass filter for feedback speed and the Coulomb friction torque is introduced and the relationship between the identified parameters and their actual values are clarified. A high-precision digital simulation model is built based on MATLAB/Simulink. The effectiveness of the proposed method is verified by simulations under various conditions.

The supply chain has incorporated products by putting them into hair scarfs. This study introduces the use of mini chips in health and beauty products and can reduce fatigue through enhanced sleep patterns. The mini chip could be placed in the scarf and used as a prototype. RFID technology provides the supply chain with specific information that is used to identify products and make communication easier. (Muhammad, et. al. 2013) This paper presents a new tool herein referred to as a scarf prototype which is developed to analyse EMG (electromyogram), ECG (electrocardiography), EEG (electroencephalogram), and EOG (electro-oculogram) signals that focuses in the area of sleep disorders. The mini chips used can be used to determine a solution for sleep disruption by using automated analytics. This could lead to improvement in our understanding of sleep disruption and overall sleep physiology. Automated technology allows repeated measurements, evaluation of sleep patterns, and provide suggestions to improve a person’s quality of sleep. This analysis compares the use of polysomnography and the scarf prototype. The analytics provide models and shows correlation between variables, such as EMG, ECG, EEG, and EOG. This study shows that the results from the scarf prototype is just as reliable as the original method, polysomnography.

Environmental monitoring programs rely on periodic spot sampling at specific locations, followed by laboratory analysis, aiming at the evaluation of water quality at a catchment scale. For this purpose, automatic telemetric stations for specific parameters have been installed by the Institute of Marine Biological Resources and Inland Waters of Hellenic Centre for Marine Research (IMBRIW-HCMR) within several Greek rivers and lakes, providing continuous and temporal monitoring possibilities. Nevertheless, the employment of unmanned surface vehicles (USV) equipped with integrated sensors represents a tool valuable to several monitoring strategies, offering enhanced temporal and spatial coverage over specific timeframes, allowing for targeted examination of sites or events of interest. The USVs have been deployed by Athens Water and Sewerage Company (EYDAP) as a cost-effective tool for the environmental monitoring of surface water bodies of interest, with emphasis on the spatial fluctuations of chlorophyllα, electrical conductivity, dissolved oxygen and pH, observed in Koumoundourou Lake and rivers Acheloos, Asopos and Kifissos. The effectiveness of an innovative heavy metal (HM) system installed in the USV for thein situ determination of copper and lead was also evaluated herewith. The results obtained demonstrate that both the timely detection of potential pollution from both anthropogenic activities and natural processes as well as the monitoring of inland waters are made feasible through the employment of USV.