Bos indicus (zebu cattle): 109567345 Help Entry 109567345         CDS       T04792                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism biu  Bos indicus (zebu cattle) Pathway biu01521   EGFR tyrosine kinase inhibitor resistance biu01524   Platinum drug resistance biu04014   Ras signaling pathway biu04064   NF-kappa B signaling pathway biu04115   p53 signaling pathway biu04137   Mitophagy - animal biu04140   Autophagy - animal biu04151   PI3K-Akt signaling pathway biu04210   Apoptosis biu04215   Apoptosis - multiple species biu04621   NOD-like receptor signaling pathway biu04630   JAK-STAT signaling pathway biu05012   Parkinson disease biu05014   Amyotrophic lateral sclerosis biu05022   Pathways of neurodegeneration - multiple diseases biu05145   Toxoplasmosis biu05162   Measles biu05166   Human T-cell leukemia virus 1 infection biu05168   Herpes simplex virus 1 infection biu05170   Human immunodeficiency virus 1 infection biu05200   Pathways in cancer biu05202   Transcriptional misregulation in cancer biu05212   Pancreatic cancer biu05220   Chronic myeloid leukemia biu05222   Small cell lung cancer biu05225   Hepatocellular carcinoma biu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109567345 (BCL2L1)    04630 JAK-STAT signaling pathway     109567345 (BCL2L1)    04064 NF-kappa B signaling pathway     109567345 (BCL2L1)    04151 PI3K-Akt signaling pathway     109567345 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109567345 (BCL2L1)    04137 Mitophagy - animal     109567345 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     109567345 (BCL2L1)    04215 Apoptosis - multiple species     109567345 (BCL2L1)    04115 p53 signaling pathway     109567345 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109567345 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109567345 (BCL2L1)    05202 Transcriptional misregulation in cancer     109567345 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     109567345 (BCL2L1)    05225 Hepatocellular carcinoma     109567345 (BCL2L1)    05220 Chronic myeloid leukemia     109567345 (BCL2L1)    05222 Small cell lung cancer     109567345 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109567345 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     109567345 (BCL2L1)    05162 Measles     109567345 (BCL2L1)    05168 Herpes simplex virus 1 infection     109567345 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     109567345 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     109567345 (BCL2L1)    05014 Amyotrophic lateral sclerosis     109567345 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     109567345 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109567345 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109567345 (BCL2L1)    01524 Platinum drug resistance     109567345 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:biu01009]     109567345 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109567345 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:biu02000]     109567345 (BCL2L1) Protein phosphatases and associated proteins [BR:biu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      109567345 (BCL2L1) Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     109567345 (BCL2L1) Transporters [BR:biu02000]  Other transporters   Pores ion channels [TC:1]    109567345 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  109567345 NCBI-ProteinID:  XP_019827773 UniProt:  A0A6P5CNW9 LinkDB All DBs Position 13:complement(62080703..62133189) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEXNRTEAPEGTESDMETPSAINGNASWHLA DSPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagtaaccgggagctggtggttgactttctctcttacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagakaacagaactgaggccccagaaggg acagaatcagatatggaaacccccagtgccatcaatggcaacgcatcctggcacctggcg gatagccctgctgtgaatggagccactggccacagcagaagctcggatgcccgggaagtg atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg taccgacgggcattcagcgacctgacgtcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggacggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacrggcatgactgtg gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system