Canis lupus dingo (dingo): 112673768 Help Entry 112673768         CDS       T08371                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism clud  Canis lupus dingo (dingo) Pathway clud01521   EGFR tyrosine kinase inhibitor resistance clud01524   Platinum drug resistance clud04014   Ras signaling pathway clud04064   NF-kappa B signaling pathway clud04115   p53 signaling pathway clud04137   Mitophagy - animal clud04140   Autophagy - animal clud04151   PI3K-Akt signaling pathway clud04210   Apoptosis clud04215   Apoptosis - multiple species clud04621   NOD-like receptor signaling pathway clud04630   JAK-STAT signaling pathway clud05012   Parkinson disease clud05014   Amyotrophic lateral sclerosis clud05022   Pathways of neurodegeneration - multiple diseases clud05145   Toxoplasmosis clud05162   Measles clud05166   Human T-cell leukemia virus 1 infection clud05168   Herpes simplex virus 1 infection clud05170   Human immunodeficiency virus 1 infection clud05200   Pathways in cancer clud05202   Transcriptional misregulation in cancer clud05212   Pancreatic cancer clud05220   Chronic myeloid leukemia clud05222   Small cell lung cancer clud05225   Hepatocellular carcinoma clud05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112673768 (BCL2L1)    04630 JAK-STAT signaling pathway     112673768 (BCL2L1)    04064 NF-kappa B signaling pathway     112673768 (BCL2L1)    04151 PI3K-Akt signaling pathway     112673768 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112673768 (BCL2L1)    04137 Mitophagy - animal     112673768 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     112673768 (BCL2L1)    04215 Apoptosis - multiple species     112673768 (BCL2L1)    04115 p53 signaling pathway     112673768 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112673768 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112673768 (BCL2L1)    05202 Transcriptional misregulation in cancer     112673768 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     112673768 (BCL2L1)    05225 Hepatocellular carcinoma     112673768 (BCL2L1)    05220 Chronic myeloid leukemia     112673768 (BCL2L1)    05222 Small cell lung cancer     112673768 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112673768 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     112673768 (BCL2L1)    05162 Measles     112673768 (BCL2L1)    05168 Herpes simplex virus 1 infection     112673768 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     112673768 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     112673768 (BCL2L1)    05014 Amyotrophic lateral sclerosis     112673768 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     112673768 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112673768 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     112673768 (BCL2L1)    01524 Platinum drug resistance     112673768 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:clud01009]     112673768 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:clud03036]     112673768 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:clud02000]     112673768 (BCL2L1) Protein phosphatases and associated proteins [BR:clud01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      112673768 (BCL2L1) Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     112673768 (BCL2L1) Transporters [BR:clud02000]  Other transporters   Pores ion channels [TC:1]    112673768 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  112673768 NCBI-ProteinID:  XP_025325431 Ensembl:  ENSCAFG00020004231 LinkDB All DBs Position 24:complement(21187312..21251722) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggca gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaaacaagcgctgagggaggctggggatgagtttgaactgagg taccggcgggcattcagtgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggatacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system