Eumetopias jubatus (Steller sea lion): 114220677 Help Entry 114220677         CDS       T07240                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju01521   EGFR tyrosine kinase inhibitor resistance eju01524   Platinum drug resistance eju04014   Ras signaling pathway eju04064   NF-kappa B signaling pathway eju04115   p53 signaling pathway eju04137   Mitophagy - animal eju04140   Autophagy - animal eju04151   PI3K-Akt signaling pathway eju04210   Apoptosis eju04215   Apoptosis - multiple species eju04621   NOD-like receptor signaling pathway eju04630   JAK-STAT signaling pathway eju05012   Parkinson disease eju05014   Amyotrophic lateral sclerosis eju05022   Pathways of neurodegeneration - multiple diseases eju05145   Toxoplasmosis eju05162   Measles eju05166   Human T-cell leukemia virus 1 infection eju05168   Herpes simplex virus 1 infection eju05170   Human immunodeficiency virus 1 infection eju05200   Pathways in cancer eju05202   Transcriptional misregulation in cancer eju05212   Pancreatic cancer eju05220   Chronic myeloid leukemia eju05222   Small cell lung cancer eju05225   Hepatocellular carcinoma eju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     114220677 (BCL2L1)    04630 JAK-STAT signaling pathway     114220677 (BCL2L1)    04064 NF-kappa B signaling pathway     114220677 (BCL2L1)    04151 PI3K-Akt signaling pathway     114220677 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114220677 (BCL2L1)    04137 Mitophagy - animal     114220677 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     114220677 (BCL2L1)    04215 Apoptosis - multiple species     114220677 (BCL2L1)    04115 p53 signaling pathway     114220677 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     114220677 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114220677 (BCL2L1)    05202 Transcriptional misregulation in cancer     114220677 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     114220677 (BCL2L1)    05225 Hepatocellular carcinoma     114220677 (BCL2L1)    05220 Chronic myeloid leukemia     114220677 (BCL2L1)    05222 Small cell lung cancer     114220677 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     114220677 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     114220677 (BCL2L1)    05162 Measles     114220677 (BCL2L1)    05168 Herpes simplex virus 1 infection     114220677 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     114220677 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     114220677 (BCL2L1)    05014 Amyotrophic lateral sclerosis     114220677 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     114220677 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114220677 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     114220677 (BCL2L1)    01524 Platinum drug resistance     114220677 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:eju01009]     114220677 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eju03036]     114220677 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:eju02000]     114220677 (BCL2L1) Protein phosphatases and associated proteins [BR:eju01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      114220677 (BCL2L1) Chromosome and associated proteins [BR:eju03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     114220677 (BCL2L1) Transporters [BR:eju02000]  Other transporters   Pores ion channels [TC:1]    114220677 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  114220677 NCBI-ProteinID:  XP_027974499 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLEAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggaagcccgggaggtg atccccatggcagcggtgaagcaagctctgagggaggccggcgatgagtttgaactgagg taccggcgggcattcagcgatctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag gtattggtgagtcggatcgcgacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagcg gccgagagccggaagggtcaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system