Hyaena hyaena (striped hyena): 120235381 Help Entry 120235381         CDS       T07257                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv01521   EGFR tyrosine kinase inhibitor resistance hhv01524   Platinum drug resistance hhv04014   Ras signaling pathway hhv04064   NF-kappa B signaling pathway hhv04115   p53 signaling pathway hhv04137   Mitophagy - animal hhv04140   Autophagy - animal hhv04151   PI3K-Akt signaling pathway hhv04210   Apoptosis hhv04215   Apoptosis - multiple species hhv04621   NOD-like receptor signaling pathway hhv04630   JAK-STAT signaling pathway hhv05012   Parkinson disease hhv05014   Amyotrophic lateral sclerosis hhv05022   Pathways of neurodegeneration - multiple diseases hhv05145   Toxoplasmosis hhv05162   Measles hhv05166   Human T-cell leukemia virus 1 infection hhv05168   Herpes simplex virus 1 infection hhv05170   Human immunodeficiency virus 1 infection hhv05200   Pathways in cancer hhv05202   Transcriptional misregulation in cancer hhv05212   Pancreatic cancer hhv05220   Chronic myeloid leukemia hhv05222   Small cell lung cancer hhv05225   Hepatocellular carcinoma hhv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     120235381 (BCL2L1)    04630 JAK-STAT signaling pathway     120235381 (BCL2L1)    04064 NF-kappa B signaling pathway     120235381 (BCL2L1)    04151 PI3K-Akt signaling pathway     120235381 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120235381 (BCL2L1)    04137 Mitophagy - animal     120235381 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     120235381 (BCL2L1)    04215 Apoptosis - multiple species     120235381 (BCL2L1)    04115 p53 signaling pathway     120235381 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120235381 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120235381 (BCL2L1)    05202 Transcriptional misregulation in cancer     120235381 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     120235381 (BCL2L1)    05225 Hepatocellular carcinoma     120235381 (BCL2L1)    05220 Chronic myeloid leukemia     120235381 (BCL2L1)    05222 Small cell lung cancer     120235381 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120235381 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     120235381 (BCL2L1)    05162 Measles     120235381 (BCL2L1)    05168 Herpes simplex virus 1 infection     120235381 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     120235381 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     120235381 (BCL2L1)    05014 Amyotrophic lateral sclerosis     120235381 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     120235381 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120235381 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     120235381 (BCL2L1)    01524 Platinum drug resistance     120235381 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hhv01009]     120235381 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hhv03036]     120235381 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:hhv02000]     120235381 (BCL2L1) Protein phosphatases and associated proteins [BR:hhv01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      120235381 (BCL2L1) Chromosome and associated proteins [BR:hhv03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     120235381 (BCL2L1) Transporters [BR:hhv02000]  Other transporters   Pores ion channels [TC:1]    120235381 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  120235381 NCBI-ProteinID:  XP_039093621 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAVNGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagcgatgtggaagagaacagaactgaggccccagaaggg actgaatcggagatggagacccccagtgccgtcaatggcaacccgtcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggacgcccgggaggtg atccccatggcagcggtgaagcaagcgctgagggaggccggggatgagtttgaactgagg taccggcgggcattcagcgacctgacgtcccagcttcacatcaccccagggacggcatat cagagcttcgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatc gtggcctttttctccttcggtggggcactgtgcgtggagagcgtggacaaagagatgcag gtactggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaacgcagcg gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system