Xenopus laevis (African clawed frog): 398251 Help Entry 398251            CDS       T01010                                  Symbol bcl2l1.S Name (RefSeq) apoptosis regulator R11   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism xla  Xenopus laevis (African clawed frog) Pathway xla04115   p53 signaling pathway xla04137   Mitophagy - animal xla04140   Autophagy - animal xla04210   Apoptosis xla04621   NOD-like receptor signaling pathway xla05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:xla00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     398251 (bcl2l1.S)    04137 Mitophagy - animal     398251 (bcl2l1.S)   09143 Cell growth and death    04210 Apoptosis     398251 (bcl2l1.S)    04115 p53 signaling pathway     398251 (bcl2l1.S)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     398251 (bcl2l1.S)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     398251 (bcl2l1.S)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:xla01009]     398251 (bcl2l1.S)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xla03036]     398251 (bcl2l1.S)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:xla02000]     398251 (bcl2l1.S) Protein phosphatases and associated proteins [BR:xla01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      398251 (bcl2l1.S) Chromosome and associated proteins [BR:xla03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     398251 (bcl2l1.S) Transporters [BR:xla02000]  Other transporters   Pores ion channels [TC:1]    398251 (bcl2l1.S) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 Bcl-2_3 BH4 Smoothelin Motif Other DBs NCBI-GeneID:  398251 NCBI-ProteinID:  XP_018092826 Xenbase:  XB-GENE-6251803 UniProt:  Q90ZH2 A0A974H0V0 LinkDB All DBs Position 9_10S:complement(18170412..18176737) Genome browser AA seq 204 aa AA seqDB search MEGSSRDLVEKFVSKKLSQNEACRKFSNNPQPNAISNGTSTSERPGEGATQGIVEEEVLQ ALLEATEEFELRYQRAFSDLTSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGR ALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGWEAFVGLYGKNAAAQSRESQE RFGRLLTIVMLTGVFALVCYMRRR NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggagggcagcagtagagatctggtggagaagtttgttagtaagaaactttcccagaat gaagcctgcaggaagttctccaataatccccaacccaatgccatatctaatggaacttct acttcagagcgccccggggaaggggccacgcagggcattgtggaggaggaagtccttcaa gcccttttggaagcaacagaggagtttgagttgagatatcagcgtgccttcagtgacctg acctcacagctgcacatcacccaggacacggcccagcagagcttccagcaagttatggga gagttgttcagggatgggacaaactgggggagaattgtggctttcttctcatttgggcgg gccctatgtgtggagagtgcaaacaaggagatgactgatctgctacccagaattgtccag tggatggtgaattatctagagcacacactgcagccctggatgcaggagaatggaggctgg gaagcttttgttggcctgtatggaaagaatgccgcagcccagagcagagaaagccaggaa cgatttggcaggttgctgactatagtgatgctgactggtgttttcgcattggtctgctac atgaggcgccgatag

DBGET integrated database retrieval system